Recombinant Sperm Whale MB Protein, His-tagged
Cat.No. : | MB-72S |
Product Overview : | Recombinant Sperm Whale MB Protein, fused to His-tag, was expressed in E. coli. |
Availability | April 19, 2025 |
Unit | |
Price | |
Qty |
- Specification
- Gene Information
- Related Products
- Download
Species : | Sperm Whale |
Source : | E.coli |
Tag : | His |
Description : | myoglobin |
Form : | PBS, pH7.4. |
Molecular Mass : | 18 kDa |
AA Sequence : | MHHHHHHVLSEGEWQLVLHVWAKVEADVAGHGQDILIRLFKSHPETLEKFDRFKHLKTEAEMKASEDLKKHGVTVLTALGAILKKKGHHEAELKPLAQSHATKHKIPIKYLEFISEAIIHVLHSRHPGDFGADAQGAMNKALELFRKDIAAKYKELGYQG |
Purity : | >95% |
Storage : | Store it under sterile conditions at -20 to -80 centigrade. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles. |
Concentration : | 1 mg/ml |
Gene Name | MB myoglobin [ Physeter catodon (sperm whale) ] |
Official Symbol | MB |
Gene ID | 102975021 |
mRNA Refseq | NM_001290722 |
Protein Refseq | NP_001277651 |
UniProt ID | P02185 |
◆ Recombinant Proteins | ||
MB-3257R | Recombinant Rat MB Protein, His (Fc)-Avi-tagged | +Inquiry |
MB-01H | Recombinant Human MB Protein, His-tagged | +Inquiry |
MB-745D | Recombinant Dog MB protein, His-tagged | +Inquiry |
MB-532C | Recombinant Cynomolgus monkey MB protein, His-tagged | +Inquiry |
MB-0028H | Recombinant Human MB Protein | +Inquiry |
◆ Native Proteins | ||
MB-01B | Native Bovine MB Protein | +Inquiry |
MB-238E | Native Horse Myoglobin | +Inquiry |
MB-237C | Native Dog Myoglobin | +Inquiry |
Mb-8232R | Native Rat Myoglobin | +Inquiry |
MB-4460H | Native Human Myoglobin | +Inquiry |
◆ Cell & Tissue Lysates | ||
MB-4446HCL | Recombinant Human MB 293 Cell Lysate | +Inquiry |
MB-4445HCL | Recombinant Human MB 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All MB Products
Required fields are marked with *
My Review for All MB Products
Required fields are marked with *
0
Inquiry Basket