Recombinant Sperm Whale MB Protein, His-tagged
| Cat.No. : | MB-72S |
| Product Overview : | Recombinant Sperm Whale MB Protein, fused to His-tag, was expressed in E. coli. |
| Unit | |
| Price | |
| Qty |
- Specification
- Gene Information
- Related Products
- Download
| Description : | myoglobin |
| Source : | E. coli |
| Species : | Sperm Whale |
| Tag : | His |
| Form : | PBS, pH7.4. |
| Molecular Mass : | 18 kDa |
| AA Sequence : | MHHHHHHVLSEGEWQLVLHVWAKVEADVAGHGQDILIRLFKSHPETLEKFDRFKHLKTEAEMKASEDLKKHGVTVLTALGAILKKKGHHEAELKPLAQSHATKHKIPIKYLEFISEAIIHVLHSRHPGDFGADAQGAMNKALELFRKDIAAKYKELGYQG |
| Purity : | ＞95% |
| Storage : | Store it under sterile conditions at -20 to -80 centigrade. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles. |
| Concentration : | 1 mg/ml |
| Gene Name | MB myoglobin [ Physeter catodon (sperm whale) ] |
| Official Symbol | MB |
| Gene ID | 102975021 |
| mRNA Refseq | NM_001290722 |
| Protein Refseq | NP_001277651 |
| UniProt ID | P02185 |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All MB Products
Required fields are marked with *
My Review for All MB Products
Required fields are marked with *
0
Inquiry Basket
