Recombinant Sperm Whale MB Protein, His-tagged

• Cat.No.: MB-72S
• Product Overview: Recombinant Sperm Whale MB Protein, fused to His-tag, was expressed in E. coli.

Specification

• Species: Sperm Whale
• Source: E.coli
• Tag: His
• Description: myoglobin
• Form: PBS, pH7.4.
• Molecular Mass: 18 kDa
• AA Sequence: MHHHHHHVLSEGEWQLVLHVWAKVEADVAGHGQDILIRLFKSHPETLEKFDRFKHLKTEAEMKASEDLKKHGVTVLTALGAILKKKGHHEAELKPLAQSHATKHKIPIKYLEFISEAIIHVLHSRHPGDFGADAQGAMNKALELFRKDIAAKYKELGYQG
• Purity: ＞95%
• Storage: Store it under sterile conditions at -20 to -80 centigrade. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
• Concentration: 1 mg/ml

Gene Information

• Gene Name: MB myoglobin [ Physeter catodon (sperm whale) ]
• Official Symbol: MB
• Gene ID: 102975021
• mRNA Refseq: NM_001290722
• Protein Refseq: NP_001277651
• UniProt ID: P02185