Recombinant Human MAZ protein(311-440 aa), C-His-tagged

• Cat.No.: MAZ-2792H
• Product Overview: Recombinant Human MAZ protein(P56270)(311-440 aa), fused with C-terminal His tag, was expressed in E. coli.

Specification

• Species: Human
• Source: E.coli
• Tag: His
• ProteinLength: 311-440 aa
• Form: 0.15 M Phosphate buffered saline
• AASequence: VCQQRFKRKDRMSYHVRSHDGAVHKPYNCSHCGKSFSRPDHLNSHVRQVHSTERPFKCEKCEAAFATKDRLRAHTVRHEEKVPCHVCGKMLSSAYISDHMKVHSQGPHHVCELCNKGTGEVCPMAAAAAA
• Storage: Shipped on dry ice. Avoid repeated freeze-thaw cycles. Upon receipt, 2 days when stored at 2 to 8 °C after thawing.
  Up to 12 months when aliquoted and stored at -20 to -80°C.
• Reconstitution: It is recommended that sterile water be added to the vial to prepare a stock solution of 0.2 ug/ul. Centrifuge the vial at 4°C before opening to recover the entire contents.

Gene Information

• Gene Name: MAZ MYC-associated zinc finger protein (purine-binding transcription factor) [ Homo sapiens ]
• Official Symbol: MAZ
• Synonyms: MAZ; MYC-associated zinc finger protein (purine-binding transcription factor); myc-associated zinc finger protein; Pur 1; ZF87; Zif87; ZNF801; MAZI; zinc finger protein 801; transcription factor Zif87; purine-binding transcription factor; serum amyloid A activating factor 1; serum amyloid A activating factor 2; zinc-finger protein, 87 kilodaltons; PUR1; Pur-1; SAF-1; SAF-2; SAF-3
• Gene ID: 4150
• mRNA Refseq: NM_001042539
• Protein Refseq: NP_001036004
• MIM: 600999
• UniProt ID: P56270