Recombinant Human MATR3 protein, GST-tagged
Cat.No. : | MATR3-16H |
Product Overview : | Recombinant Human MATR3(1 a.a. - 847 a.a.) fused with GST tag at N-terminal was expressed in Wheat Germ. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Wheat Germ |
Tag : | GST |
Protein Length : | 1-847 a.a. |
Description : | This gene encodes a nuclear matrix protein, which is proposed to stabilize certain messenger RNA species. Mutations of this gene are associated with distal myopathy 2, which often includes vocal cord and pharyngeal weakness. Alternatively spliced transcript variants, including read-through transcripts composed of the upstream small nucleolar RNA host gene 4 (non-protein coding) and matrin 3 gene sequence, have been identified. Pseudogenes of this gene are located on chromosomes 1 and X. |
Form : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Molecular Mass : | 121Da |
AA Sequence : | MSKSFQQSSLSRDSQGHGRDLSAAGIGLLAAATQSLSMPASLGRMNQGTARLASLMNLGMSSSLNQQGAHSALSS ASTSSHNLQSIFNIGSRGPLPLSSQHRGDADQASNILASFGLSARDLDELSRYPEDKITPENLPQILLQLKRRRT EEGPTLSYGRDGRSATREPPYRVPRDDWEEKRHFRRDSFDDRGPSLNPVLDYDHGSRSQESGYYDRMDYEDDRLR DGERCRDDSFFGETSHNYHKFDSEYERMGRGPGPLQERSLFEKKRGAPPSSNIEDFHGLLPKGYPHLCSICDLPV HSNKEWSQHINGASHSRRCQLLLEIYPEWNPDNDTGHTMGDPFMLQQSTNPAPGILGPPPPSFHLGGPAVGPRGN LGAGNGNLQGPRHMQKGRVETSRVVHIMDFQRGKNLRYQLLQLVEPFGVISNHLILNKINEAFIEMATTEDAQAA VDYYTTTPALVFGKPVRVHLSQKYKRIKKPEGKPDQKFDQKQELGRVIHLSNLPHSGYSDSAVLKLAEPYGKIKN YILMRMKSQAFIEMETREDAMAMVDHCLKKALWFQGRCVKVDLSEKYKKLVLRIPNRGIDLLKKDKSRKRSYSPD GKESPSDKKSKTDGSQKTESSTEGKEQEEKSGEDGEKDTKDDQTEQEPNMLLESEDELLVDEEEAAALLESGSSV GDETDLANLGDVASDGKKEPSDKAVKKDGSASAAAKKKLKKVDKIEELDQENEAALENGIKNEENTEPGAESSEN ADDPNKDTSENADGQSDENKDDYTIPDEYRIGPYQPNVPVGIDYVIPKTGFYCKLCSLFYTNEEVAKNTHCSSLP HYQKLKKFLNKLAEERRQKKET |
Applications : | Enzyme-linked Immunoabsorbent Assay; Western Blot (Recombinant protein); Antibody Production; Protein Array |
Notes : | Best use within three months from the date of receipt of this protein. |
Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
Gene Name | MATR3 matrin 3 [ Homo sapiens ] |
Official Symbol | MATR3 |
Synonyms | MATR3; matrin 3; MPD2, myopathy, distal 2; matrin-3; KIAA0723; MGC9105; VCPDM; vocal cord and pharyngeal weakness with distal myopathy; MPD2; DKFZp686K0542; DKFZp686K23100; |
Gene ID | 9782 |
mRNA Refseq | NM_018834 |
Protein Refseq | NP_061322 |
MIM | 164015 |
UniProt ID | P43243 |
Chromosome Location | 5q31.3 |
Function | RNA binding; metal ion binding; nucleic acid binding; nucleotide binding; protein binding; structural molecule activity; zinc ion binding; |
◆ Recombinant Proteins | ||
MATR3-16H | Recombinant Human MATR3 protein, GST-tagged | +Inquiry |
MATR3-3598R | Recombinant Rat MATR3 Protein | +Inquiry |
MATR3-652HF | Recombinant Full Length Human MATR3 Protein, GST-tagged | +Inquiry |
MATR3-3254R | Recombinant Rat MATR3 Protein, His (Fc)-Avi-tagged | +Inquiry |
MATR3-4881HFL | Recombinant Full Length Human MATR3 protein, Flag-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
MATR3-4447HCL | Recombinant Human MATR3 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All MATR3 Products
Required fields are marked with *
My Review for All MATR3 Products
Required fields are marked with *
0
Inquiry Basket