Recombinant Human mastadenovirus C E4 protein, T7/His-tagged

• Cat.No.: E4-199H
• Product Overview: Recombinant adenovirus E4orf1 (128 aa) fused with T7-His-TEV cleavage site Tag at N-terminal and 11R tag at C-terminal was expressed in E. coli.

Specification

• Species: Human mastadenovirus C
• Source: E.coli
• Tag: His&T7
• Form: 0.5 mg/ml, sterile-filtered, in 20 mM pH 8.0 Tris-HCl Buffer, with proprietary formulation of NaCl, KCl, Sucrose and DTT.
• AA Sequence: MASMTGGQQMGRGHHHHHHENLYFQGEFAAAVEALYVVLEREGAILPRQEGFSGVYVFFSPINFVIPPMGAVMLS LRLRVCIPPGYFGRFLALTDVNQPDVFTESYIMTPDMTEELSVVLFNHGDQFFYGHAGMAVVRLMLIRVVFPVVR QASNVLESGGGGSPGRRRRRRRRRRR
• Purity: >90% by SDS-PAGE
• Applications: 1. May be used for in vitro adenovirus E4ORF1 mediated human endothelial cell differentiation regulation study by intracellular delivery of this protein.2. May be used for mapping E4ORF1 protein-protein interaction.3. May be used as specific substrate protein for kinase and ubiquitin (Sumo pathway) related enzyme functional screening assays.4. As antigen for specific antibody production.
• Storage: Keep at -80 centigrade for long term storage. Product is stable at 4 centigrade for at least 7 days.

Gene Information

• Gene Name: E4 control protein E4orf6/7 [ Human adenovirus C ]
• Official Symbol: E4
• Synonyms: control protein E4orf6/7; control protein E4 34K; control protein E4orf4; control protein E4orf3; control protein E4orf2; control protein E4orf1
• Gene ID: 2652989