Recombinant Human MAST4 Protein, Myc/DDK-tagged, C13 and N15-labeled

• Cat.No.: MAST4-4360H
• Product Overview: MAST4 MS Standard C13 and N15-labeled recombinant protein (NP_942123) with a C-terminal MYC/DDK tag, was expressed in HEK293 cells.

Specification

• Species: Human
• Source: HEK293
• Tag: Myc&DDK
• Description: This gene encodes a member of the microtubule-associated serine/threonine protein kinases. The proteins in this family contain a domain that gives the kinase the ability to determine its own scaffold to control the effects of their kinase activities. Alternative splicing results in multiple transcript variants encoding different isoforms.
• Molecular Mass: 25.5 kDa
• AA Sequence: MGEKVSEAPEPVPRGCSGHGSRTPASALVAASSPGASSAESSSGSETLSEEGEPGGFSREHQPPPPPPLGGTLGARAPAAWAPASVLLERGVLALPPPLPGGAVPPAPRGSSASQEEQDEELDHILSPPPMPFRKCSNPDVASGPGKSLKYKRQLSEDGRQLRRGSLGGALTGRYLLPNPVAGQAWPASAETSNLVRMRSQALGQSAPSLTASLKELSLPRRGSLIDSQKWNCLVKRPVCPNAGRTSPLGTRTRPLEQKLISEEDLAANDILDYKDDDDKV
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Stability: Stable for 3 months from receipt of products under proper storage and handling conditions.
• Storage: Store at -80 centigrade. Avoid repeated freeze-thaw cycles.
• Concentration: 50 μg/mL as determined by BCA
• Storage Buffer: 100 mM glycine, 25 mM Tris-HCl, pH 7.3.

Gene Information

• Gene Name: MAST4 microtubule associated serine/threonine kinase family member 4 [ Homo sapiens (human) ]
• Official Symbol: MAST4
• Synonyms: MAST4; microtubule associated serine/threonine kinase family member 4; microtubule-associated serine/threonine-protein kinase 4; KIAA0303; FLJ16540; FLJ33039; DKFZp686N1467; DKFZp686E18148
• Gene ID: 375449
• mRNA Refseq: NM_198828
• Protein Refseq: NP_942123
• MIM: 618002
• UniProt ID: O15021