Recombinant Human MASP2 protein, GST-tagged

• Cat.No.: MASP2-45H
• Product Overview: Recombinant Human MASP2(1 a.a. - 686 a.a.) fused with GST tag at the C-terminus was expressed in Wheat Germ.

Specification

• Species: Human
• Source: Wheat Germ
• Tag: GST
• Protein Length: 1-686 a.a.
• Form: 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
• Molecular Mass: 102.1 kDa
• AA Sequence: MRLLTLLGLLCGSVATPLGPKWPEPVFGRLASPGFPGEYANDQERRWTLTAPPGYRLRLYFTHFDLELSHLCEYD FVKLSSGAKVLATLCGQESTDTERAPGKDTFYSLGSSLDITFRSDYSNEKPFTGFEAFYAAEDIDECQVAPGEAP TCDHHCHNHLGGFYCSCRAGYVLHRNKRTCSALCSGQVFTQRSGELSSPEYPRPYPKLSSCTYSISLEEGFSVIL DFVESFDVETHPETLCPYDFLKIQTDREEHGPFCGKTLPHRIETKSNTVTITFVTDESGDHTGWKIHYTSTAQPC PYPMAPPNGHVSPVQAKYILKDSFSIFCETGYELLQGHLPLKSFTAVCQKDGSWDRPMPACSIVDCGPPDDLPSG RVEYITGPGVTTYKAVIQYSCEETFYTMKVNDGKYVCEADGFWTSSKGEKSLPVCEPVCGLSARTTGGRIYGGQK AKPGDFPWQVLILGGTTAAGALLYDNWVLTAAHAVYEQKHDASALDIRMGTLKRLSPHYTQAWSEAVFIHEGYTH DAGFDNDIALIKLNNKVVINSNITPICLPRKEAESFMRTDDIGTASGWGLTQRGFLARNLMYVDIPIVDHQKCTA AYEKPPYPRGSVTANMLCAGLESGGKDSCRGDSGGALVFLDSETERWFVGGIVSWGSMNCGEAGQYGVYTKVINY IPWIENIISDF
• Applications: Enzyme-linked Immunoabsorbent Assay; Western Blot (Recombinant protein); Antibody Production; Protein Array
• Notes: Best use within three months from the date of receipt of this protein.
• Storage: Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.

Gene Information

• Gene Name: MASP2 mannan-binding lectin serine peptidase 2 [ Homo sapiens ]
• Official Symbol: MASP2
• Synonyms: MASP2; mannan-binding lectin serine peptidase 2; mannan binding lectin serine peptidase 1 pseudogene 1 , mannan binding lectin serine protease 1 pseudogene 1 , mannan binding lectin serine protease 2 , MASP1P1; mannan-binding lectin serine protease 2; small MBL-associated protein; MBL-associated serine protease 2; MBL-associated plasma protein of 19 kD; mannan-binding lectin serine protease 1 pseudogene 1; mannose-binding protein-associated serine protease 2; mannan-binding lectin serine peptidase 1 pseudogene 1; sMAP; MAP19; MASP-2; MASP1P1
• Gene ID: 10747
• mRNA Refseq: NM_006610
• Protein Refseq: NP_006601
• MIM: 605102
• UniProt ID: O00187
• Chromosome Location: 1p36.3-p36.2
• Pathway: Complement and Coagulation Cascades, organism-specific biosystem; Complement and coagulation cascades, organism-specific biosystem; Complement and coagulation cascades, conserved biosystem; Complement cascade, organism-specific biosystem; Creation of C4 and C2 activators, organism-specific biosystem; Immune System, organism-specific biosystem; Initial triggering of complement, organism-specific biosystem
• Function: calcium ion binding; calcium-dependent protein binding; peptidase activity; protein binding; serine-type endopeptidase activity