Recombinant Human MARK1 protein, GST-tagged

• Cat.No.: MARK1-30185H
• Product Overview: Recombinant Human MARK1 (506-611 aa) protein, fused to GST tag, was expressed in E. coli.

Specification

• Species: Human
• Source: E.coli
• Tag: GST
• ProteinLength: Val506-Arg611
• Form: The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH8.). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization.
• AA Sequence: VCERTTDRYVALQNGKDSSLTEMSVSSISSAGSSVASAVPSARPRHQKSMSTSGHPIKVTLPTIKDGSEAYRPGTTQRVPAASPSAHSISTATPDRTRFPRGSSSR
• Purity: 85%, by SDS-PAGE with Coomassie Brilliant Blue staining.
• Stability: Store for up to 12 months at -20°C to -80°C as lyophilized powder.
• Storage: Short-term storage: Store at 2-8°C for (1-2 weeks).
  Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, buffer containing 50% glycerol is recommended for reconstitution. Avoid repeat freeze-thaw cycles.

Gene Information

• Gene Name: MARK1 MAP/microtubule affinity-regulating kinase 1 [ Homo sapiens ]
• Official Symbol: MARK1
• Synonyms: MARK1; MAP/microtubule affinity-regulating kinase 1; serine/threonine-protein kinase MARK1; MARK; PAR1 homolog c; Par1c; Par-1c; KIAA1477; MGC126512; MGC126513
• Gene ID: 4139
• mRNA Refseq: NM_018650
• Protein Refseq: NP_061120
• MIM: 606511
• UniProt ID: Q9P0L2