Recombinant Human MARCH10 Protein, GST-tagged

Cat.No. : MARCH10-4316H
Product Overview : Human FLJ35757 partial ORF ( NP_689811, 76 a.a. - 184 a.a.) recombinant protein with GST-tag at N-terminal.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : Wheat Germ
Tag : GST
Description : MARCH10 is a member of the MARCH family of membrane-bound E3 ubiquitin ligases (EC 6.3.2.19). MARCH enzymes add ubiquitin (see MIM 191339) to target lysines in substrate proteins, thereby signaling their vesicular transport between membrane compartments (Morokuma et al., 2007 [PubMed 17604280]).[supplied by OMIM, Apr 2010]
Molecular Mass : 37.73 kDa
AA Sequence : DALTEPRSSIKISAFKCDSKLPAIDQTSVKQKHKSTMTVRKAEKVDPSEPSPADQAPMVLLRKRKPNLRRFTVSPESHSPRASGDRSRQKQQWPAKVPVPRGADQVVQQ
Applications : Enzyme-linked Immunoabsorbent Assay
Western Blot (Recombinant protein)
Antibody Production
Protein Array
Notes : Best use within three months from the date of receipt of this protein.
Storage : Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
Storage Buffer : 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Gene Name MARCH10 membrane-associated ring finger (C3HC4) 10, E3 ubiquitin protein ligase [ Homo sapiens ]
Official Symbol MARCH10
Synonyms RNF190; MARCH-X; MARCH10; membrane-associated ring finger (C3HC4) 10, E3 ubiquitin protein ligase; Membrane Associated Ring-CH-Type Finger 10; Membrane-Associated Ring Finger (C3HC4) 10, E3 Ubiquitin Protein Ligase 2; Membrane-Associated RING Finger Protein 10; RING-Type E3 Ubiquitin Transferase MARCH10; Membrane-Associated RING-CH Protein X; Ring Finger Protein 190; MARCH-X; RNF190; Testis Secretory Sperm-Binding Protein Li 228n; Probable E3 Ubiquitin-Protein Ligase MARCH10; Membrane-Associated Ring Finger (C3HC4) 10; Membrane Associated Ring Finger 10; RING Finger Protein 190; EC 2.3.2.27
Gene ID 162333
mRNA Refseq NM_152598
Protein Refseq NP_689811
MIM 613337
UniProt ID Q8NA82

Not For Human Consumption!

Inquiry

  • Reviews
  • Q&As

Customer Reviews (0)

Write a review

Q&As (0)

Ask a question

Ask a Question for All MARCH10 Products

Required fields are marked with *

My Review for All MARCH10 Products

Required fields are marked with *

0

Inquiry Basket

cartIcon