Recombinant Human MARCH10 Protein, GST-tagged
Cat.No. : | MARCH10-4316H |
Product Overview : | Human FLJ35757 partial ORF ( NP_689811, 76 a.a. - 184 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Wheat Germ |
Tag : | GST |
Description : | MARCH10 is a member of the MARCH family of membrane-bound E3 ubiquitin ligases (EC 6.3.2.19). MARCH enzymes add ubiquitin (see MIM 191339) to target lysines in substrate proteins, thereby signaling their vesicular transport between membrane compartments (Morokuma et al., 2007 [PubMed 17604280]).[supplied by OMIM, Apr 2010] |
Molecular Mass : | 37.73 kDa |
AA Sequence : | DALTEPRSSIKISAFKCDSKLPAIDQTSVKQKHKSTMTVRKAEKVDPSEPSPADQAPMVLLRKRKPNLRRFTVSPESHSPRASGDRSRQKQQWPAKVPVPRGADQVVQQ |
Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
Notes : | Best use within three months from the date of receipt of this protein. |
Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
Storage Buffer : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Gene Name | MARCH10 membrane-associated ring finger (C3HC4) 10, E3 ubiquitin protein ligase [ Homo sapiens ] |
Official Symbol | MARCH10 |
Synonyms | RNF190; MARCH-X; MARCH10; membrane-associated ring finger (C3HC4) 10, E3 ubiquitin protein ligase; Membrane Associated Ring-CH-Type Finger 10; Membrane-Associated Ring Finger (C3HC4) 10, E3 Ubiquitin Protein Ligase 2; Membrane-Associated RING Finger Protein 10; RING-Type E3 Ubiquitin Transferase MARCH10; Membrane-Associated RING-CH Protein X; Ring Finger Protein 190; MARCH-X; RNF190; Testis Secretory Sperm-Binding Protein Li 228n; Probable E3 Ubiquitin-Protein Ligase MARCH10; Membrane-Associated Ring Finger (C3HC4) 10; Membrane Associated Ring Finger 10; RING Finger Protein 190; EC 2.3.2.27 |
Gene ID | 162333 |
mRNA Refseq | NM_152598 |
Protein Refseq | NP_689811 |
MIM | 613337 |
UniProt ID | Q8NA82 |
◆ Recombinant Proteins | ||
MARCH10-549H | Recombinant Human MARCH10 Protein, His-tagged | +Inquiry |
MARCH10-4316H | Recombinant Human MARCH10 Protein, GST-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
MARCH10-4475HCL | Recombinant Human MARCH10 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All MARCH10 Products
Required fields are marked with *
My Review for All MARCH10 Products
Required fields are marked with *
0
Inquiry Basket