Recombinant Human MAPKAPK5 protein, GST-tagged

• Cat.No.: MAPKAPK5-1216H
• Product Overview: Recombinant Human MAPKAPK5 protein(232-471 aa), fused to GST tag, was expressed in E. coli.

Specification

• Source: E. coli
• Species: Human
• Tag: GST
• Form: The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH8.). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization. The elution buffer contain 100mM GSH.
• Protein length: 232-471 aa
• AA Sequence: YVMLCGYPPFYSKHHSRTIPKDMRRKIMTGSFEFPEEEWSQISEMAKDVVRKLLKVKPEERLTIEGVLDHPWLNSTEALDNVLPSAQLMMDKAVVAGIQQAHAEQLANMRIQDLKVSLKPLHSVNNPILRKRKLLGTKPKDSVYIHDHENGAEDSNVALEKLRDVIAQCILPQAGENEDEKLNEVMQEAWKYNRECKLLRDTLQSFSWNGRGFTDKVDRLKLAEIVKQVIEEQTTSHESQ
• Purity: 90%, by SDS-PAGE with Coomassie Brilliant Blue staining.
• Storage: Aliquot and store at -20°C to -80°C for up to 3 months, buffer containing 50% glycerol is recommended for reconstitution. Avoid repeat freeze-thaw cycles.
• Reconstitution: Reconstitute at 0.25 µg/μl in 200 μl sterile water for short-term storage.
  Reconstitution with 200 μl 50% glycerol solution is recommended for longer term storage.

Gene Information

• Gene Name: MAPKAPK5 mitogen-activated protein kinase-activated protein kinase 5 [ Homo sapiens ]
• Official Symbol: MAPKAPK5
• Synonyms: MAPKAPK5; mitogen-activated protein kinase-activated protein kinase 5; MAP kinase-activated protein kinase 5; PRAK; MAPKAPK-5; MAPKAP kinase 5; MAPK-activated protein kinase 5; p38-regulated/activated protein kinase; MK5; MK-5; MAPKAP-K5
• Gene ID: 8550
• mRNA Refseq: NM_003668
• Protein Refseq: NP_003659
• MIM: 606723
• UniProt ID: Q8IW41