Recombinant Human MAPK13 protein, His-SUMO-tagged

• Cat.No.: MAPK13-3205H
• Product Overview: Recombinant Human MAPK13 protein(O15264)(1-365aa), fused to N-terminal His tag and SUMO tag, was expressed in E. coli.

Specification

• Source: E. coli
• Species: Human
• Tag: His&SUMO
• Form: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol.
  If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
• Molecular Mass: 58.1 kDa
• Protein length: 1-365aa
• AA Sequence: MSLIRKKGFYKQDVNKTAWELPKTYVSPTHVGSGAYGSVCSAIDKRSGEKVAIKKLSRPFQSEIFAKRAYRELLLLKHMQHENVIGLLDVFTPASSLRNFYDFYLVMPFMQTDLQKIMGMEFSEEKIQYLVYQMLKGLKYIHSAGVVHRDLKPGNLAVNEDCELKILDFGLARHADAEMTGYVVTRWYRAPEVILSWMHYNQTVDIWSVGCIMAEMLTGKTLFKGKDYLDQLTQILKVTGVPGTEFVQKLNDKAAKSYIQSLPQTPRKDFTQLFPRASPQAADLLEKMLELDVDKRLTAAQALTHPFFEPFRDPEEETEAQQPFDDSLEHEKLTVDEWKQHIYKEIVNFSPIARKDSRRRSGMKL
• Purity: Greater than 90% as determined by SDS-PAGE.
• Storage: Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
• Reconstitution: Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%.

Gene Information

• Gene Name: MAPK13 mitogen-activated protein kinase 13 [ Homo sapiens ]
• Official Symbol: MAPK13
• Synonyms: MAPK13; mitogen-activated protein kinase 13; PRKM13; p38delta; SAPK4; MAPK 13; MAP kinase 13; MAP kinase p38 delta; stress-activated protein kinase 4; mitogen-activated protein kinase p38 delta; MGC99536
• Gene ID: 5603
• mRNA Refseq: NM_002754
• Protein Refseq: NP_002745
• MIM: 602899
• UniProt ID: O15264