Recombinant Human MAPK12 protein, GST-tagged

• Cat.No.: MAPK12-3014H
• Product Overview: Recombinant Human MAPK12 (216-349 aa) protein, fused to GST tag, was expressed in E. coli.

Specification

• Source: E. coli
• Species: Human
• Tag: GST
• Form: The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH8.). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization.
• Protein length: Met216-Leu349
• AA Sequence: MAEMITGKTLFKGSDHLDQLKEIMKVTGTPPAEFVQRLQSDEAKNYMKGLPELEKKDFASILTNASPLAVNLLEKMLVLDAEQRVTAGEALAHPYFESLHDTEDEPQVQKYDDSFDDVDRTLDEWKRVTYKEVL
• Purity: 90%, by SDS-PAGE with Coomassie Brilliant Blue staining.
• Stability: Store for up to 12 months at -20°C to -80°C as lyophilized powder.
• Storage: Short-term storage: Store at 2-8°C for (1-2 weeks).
  Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, buffer containing 50% glycerol is recommended for reconstitution. Avoid repeat freeze-thaw cycles.
• Reconstitution: Reconstitute at 0.25 µg/μl in 200 μl sterile water for short-term storage.
  Reconstitution with 200 μl 50% glycerol solution is recommended for longer term storage.

Gene Information

• Gene Name: MAPK12 mitogen-activated protein kinase 12 [ Homo sapiens ]
• Official Symbol: MAPK12
• Synonyms: MAPK12; mitogen-activated protein kinase 12; SAPK3; ERK6; p38gamma; PRKM12; SAPK 3; ERK-6; MAPK 12; MAP kinase 12; MAP kinase p38 gamma; stress-activated protein kinase 3; mitogen-activated protein kinase 3; extracellular signal-regulated kinase 6; mitogen-activated protein kinase p38 gamma; ERK3; SAPK-3; P38GAMMA
• Gene ID: 6300
• mRNA Refseq: NM_002969
• Protein Refseq: NP_002960
• MIM: 602399
• UniProt ID: P53778