Recombinant Human MAP3K14 protein, His-tagged

Cat.No. : MAP3K14-814H
Product Overview : Recombinant Human MAP3K14 protein(NP_003945)(401-707 aa), fused to His tag, was expressed in E. coli.
  • Specification
  • Gene Information
  • Related Products
  • Download
Source : E. coli
Species : Human
Tag : His
Form : The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH7.4). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization.
Protein length : 401-707 aa
AA Sequence : THQLRLGRGSFGEVHRMEDKQTGFQCAVKKVRLEVFRAEELMACAGLTSPRIVPLYGAVREGPWVNIFMELLEGGSLGQLVKEQGCLPEDRALYYLGQALEGLEYLHSRRILHGDVKADNVLLSSDGSHAALCDFGHAVCLQPDGLGKSLLTGDYIPGTETHMAPEVVLGRSCDAKVDVWSSCCMMLHMLNGCHPWTQFFRGPLCLKIASEPPPVREIPPSCAPLTAQAIQEGLRKEPIHRVSAAELGGKVNRALQQVGGLKSPWRGEYKEPRHPPPNQANYHQTLHAQPRELSPRAPGPRPAEETT
Purity : 95%, by SDS-PAGE with Coomassie Brilliant Blue staining.
Storage : Aliquot and store at -20°C to -80°C for up to 6 months. Avoid repeat freeze-thaw cycles.
Concentration : The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH7.4). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization.
Reconstitution : Reconstitute at 0.25 µg/μl in 200 μl sterile water for short-term storage.
Reconstitution with 200 μl 50% glycerol solution is recommended for longer term storage.
Gene Name MAP3K14 mitogen-activated protein kinase kinase kinase 14 [ Homo sapiens ]
Official Symbol MAP3K14
Synonyms MAP3K14; mitogen-activated protein kinase kinase kinase 14; FTDCR1B; HS; HSNIK; NIK; serine/threonine protein kinase; NF-kappa-beta-inducing kinase; serine/threonine protein-kinase; serine/threonine-protein kinase NIK;
Gene ID 9020
mRNA Refseq NM_003954
Protein Refseq NP_003945
MIM 604655
UniProt ID Q99558

Not For Human Consumption!

Inquiry

  • Reviews
  • Q&As

Customer Reviews (0)

Write a review

Q&As (0)

Ask a question

Ask a Question for All MAP3K14 Products

Required fields are marked with *

My Review for All MAP3K14 Products

Required fields are marked with *

0

Inquiry Basket

cartIcon