Recombinant Human MAP2K6 protein, His-tagged

• Cat.No.: MAP2K6-2241H
• Product Overview: Recombinant Human MAP2K6 protein(P52564)(1-334aa), fused to N-terminal His tag, was expressed in Insect Cell.

Specification

• Source: Insect Cell
• Species: Human
• Tag: His
• Form: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol.
  If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
• Molecular Mass: 39.5 kDa
• Protein length: 1-334aa
• AA Sequence: MSQSKGKKRNPGLKIPKEAFEQPQTSSTPPRDLDSKACISIGNQNFEVKADDLEPIMELGRGAYGVVEKMRHVPSGQIMAVKRIRATVNSQEQKRLLMDLDISMRTVDCPFTVTFYGALFREGDVWICMELMDTSLDKFYKQVIDKGQTIPEDILGKIAVSIVKALEHLHSKLSVIHRDVKPSNVLINALGQVKMCDFGISGYLVDSVAKTIDAGCKPYMAPERINPELNQKGYSVKSDIWSLGITMIELAILRFPYDSWGTPFQQLKQVVEEPSPQLPADKFSAEFVDFTSQCLKKNSKERPTYPELMQHPFFTLHESKGTDVASFVKLILGD
• Purity: Greater than 90% as determined by SDS-PAGE.
• Storage: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
• Reconstitution: Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Gene Information

• Gene Name: MAP2K6 mitogen-activated protein kinase kinase 6 [ Homo sapiens ]
• Official Symbol: MAP2K6
• Synonyms: MAP2K6; mitogen-activated protein kinase kinase 6; PRKMK6; dual specificity mitogen-activated protein kinase kinase 6; MAPKK6; MEK6; MKK6; protein kinase; mitogen activated; kinase 6 (MAP kinase kinase 6); SAPKK3; MEK 6; MAPKK 6; SAPK kinase 3; MAPK/ERK kinase 6; stress-activated protein kinase kinase 3; protein kinase, mitogen-activated, kinase 6 (MAP kinase kinase 6); SAPKK-3
• Gene ID: 5608
• mRNA Refseq: NM_002758
• Protein Refseq: NP_002749
• MIM: 601254
• UniProt ID: P52564