Recombinant Human MAP2K6 protein, His-SUMO-tagged
Cat.No. : | MAP2K6-3203H |
Product Overview : | Recombinant Human MAP2K6 protein(P52564)(1-334aa), fused to N-terminal His tag and SUMO tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His&SUMO |
Protein Length : | 1-334aa |
Form : | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
Molecular Mass : | 53.5 kDa |
AA Sequence : | MSQSKGKKRNPGLKIPKEAFEQPQTSSTPPRDLDSKACISIGNQNFEVKADDLEPIMELGRGAYGVVEKMRHVPSGQIMAVKRIRATVNSQEQKRLLMDLDISMRTVDCPFTVTFYGALFREGDVWICMELMDTSLDKFYKQVIDKGQTIPEDILGKIAVSIVKALEHLHSKLSVIHRDVKPSNVLINALGQVKMCDFGISGYLVDSVAKTIDAGCKPYMAPERINPELNQKGYSVKSDIWSLGITMIELAILRFPYDSWGTPFQQLKQVVEEPSPQLPADKFSAEFVDFTSQCLKKNSKERPTYPELMQHPFFTLHESKGTDVASFVKLILGD |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Reconstitution : | Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. |
Gene Name | MAP2K6 mitogen-activated protein kinase kinase 6 [ Homo sapiens ] |
Official Symbol | MAP2K6 |
Synonyms | MAP2K6; mitogen-activated protein kinase kinase 6; PRKMK6; dual specificity mitogen-activated protein kinase kinase 6; MAPKK6; MEK6; MKK6; protein kinase; mitogen activated; kinase 6 (MAP kinase kinase 6); SAPKK3; MEK 6; MAPKK 6; SAPK kinase 3; MAPK/ERK kinase 6; stress-activated protein kinase kinase 3; protein kinase, mitogen-activated, kinase 6 (MAP kinase kinase 6); SAPKK-3; |
Gene ID | 5608 |
mRNA Refseq | NM_002758 |
Protein Refseq | NP_002749 |
MIM | 601254 |
UniProt ID | P52564 |
◆ Recombinant Proteins | ||
MAP2K6-4007HF | Active Recombinant Full Length Human MAP2K6 Protein, GST-tagged | +Inquiry |
MAP2K6-2665R | Recombinant Rhesus monkey MAP2K6 Protein, His-tagged | +Inquiry |
MAP2K6-5007H | Recombinant Human MAP2K6 Protein (Phe46-Pro306), N-His tagged | +Inquiry |
MAP2K6-3059H | Recombinant Human MAP2K6 protein, His-tagged | +Inquiry |
MAP2K6-440HFL | Active Recombinant Full Length Human MAP2K6 Protein, C-Flag-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
MAP2K6-001HCL | Recombinant Human MAP2K6 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All MAP2K6 Products
Required fields are marked with *
My Review for All MAP2K6 Products
Required fields are marked with *
0
Inquiry Basket