Active Recombinant Full Length Human MAP2K6 Protein, C-Flag-tagged
Cat.No. : | MAP2K6-440HFL |
Product Overview : | Recombinant Full Length Human MAP2K6 Protein, fused to Flag-tag at C-terminus, was expressed in Mammalian cells. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Mammalian Cells |
Tag : | Flag |
Description : | This gene encodes a member of the dual specificity protein kinase family, which functions as a mitogen-activated protein (MAP) kinase kinase. MAP kinases, also known as extracellular signal-regulated kinases (ERKs), act as an integration point for multiple biochemical signals. This protein phosphorylates and activates p38 MAP kinase in response to inflammatory cytokines or environmental stress. As an essential component of p38 MAP kinase mediated signal transduction pathway, this gene is involved in many cellular processes such as stress induced cell cycle arrest, transcription activation and apoptosis. |
Form : | 25 mM Tris HCl, pH 7.3, 100 mM glycine, 10% glycerol. |
Bio-activity : | In vitro kinase assay substrate |
Molecular Mass : | 37.3 kDa |
AA Sequence : | MSQSKGKKRNPGLKIPKEAFEQPQTSSTPPRDLDSKACISIGNQNFEVKADDLEPIMELGRGAYGVVEKM RHVPSGQIMAVKRIRATVNSQEQKRLLMDLDISMRTVDCPFTVTFYGALFREGDVWICMELMDTSLDKFY KQVIDKGQTIPEDILGKIAVSIVKALEHLHSKLSVIHRDVKPSNVLINALGQVKMCDFGISGYLVDSVAK TIDAGCKPYMAPERINPELNQKGYSVKSDIWSLGITMIELAILRFPYDSWGTPFQQLKQVVEEPSPQLPA DKFSAEFVDFTSQCLKKNSKERPTYPELMQHPFFTLHESKGTDVASFVKLILGDTRTRPLEQKLISEEDLAANDILDYKDDDDKV |
Purity : | > 80% as determined by SDS-PAGE and Coomassie blue staining. |
Stability : | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Storage : | Store at -80 centigrade. |
Concentration : | >50 ug/mL as determined by microplate BCA method. |
Preparation : | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Protein Families : | Druggable Genome, Protein Kinase |
Protein Pathways : | Amyotrophic lateral sclerosis (ALS), Fc epsilon RI signaling pathway, GnRH signaling pathway, MAPK signaling pathway, Toll-like receptor signaling pathway |
Full Length : | Full L. |
Gene Name | MAP2K6 mitogen-activated protein kinase kinase 6 [ Homo sapiens (human) ] |
Official Symbol | MAP2K6 |
Synonyms | MEK6; MKK6; MAPKK6; PRKMK6; SAPKK3; SAPKK-3 |
Gene ID | 5608 |
mRNA Refseq | NM_002758.4 |
Protein Refseq | NP_002749.2 |
MIM | 601254 |
UniProt ID | P52564 |
◆ Recombinant Proteins | ||
MAP2K6-34H | Recombinant human biotinylated MAP2K6, His-tagged | +Inquiry |
MAP2K6-47H | Recombinant Human MEK6, GST-tagged | +Inquiry |
MAP2K6-9245Z | Recombinant Zebrafish MAP2K6 | +Inquiry |
Map2k6-3924M | Recombinant Mouse Map2k6 Protein, Myc/DDK-tagged | +Inquiry |
MAP2K6-5007H | Recombinant Human MAP2K6 Protein (Phe46-Pro306), N-His tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
MAP2K6-001HCL | Recombinant Human MAP2K6 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All MAP2K6 Products
Required fields are marked with *
My Review for All MAP2K6 Products
Required fields are marked with *
0
Inquiry Basket