Recombinant Human MAP2K3 protein, MBP&His-Avi-tagged, Biotinylated

• Cat.No.: MAP2K3-785H
• Product Overview: Biotinylated Recombinant Human MAP2K3 protein(P46734)(1-347aa), fused with N-terminal MBP tag and C-terminal His and Avi tag, was expressed in E.coli.

Specification

• Species: Human
• Source: E.coli
• Tag: Avi&His&MBP
• Protein Length: 1-347a.a.
• Tag: MBP&His&Avi
• Conjugation/Label: Biotin
• Form: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
• Molecular Mass: 87.1 kDa
• Purity: Greater than 85% as determined by SDS-PAGE.
• Storage: Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
• Reconstitution: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C.
• AA Sequence: MESPASSQPASMPQSKGKSKRKKDLRISCMSKPPAPNPTPPRNLDSRTFITIGDRNFEVEADDLVTISELGRGAYGVVEKVRHAQSGTIMAVKRIRATVNSQEQKRLLMDLDINMRTVDCFYTVTFYGALFREGDVWICMELMDTSLDKFYRKVLDKNMTIPEDILGEIAVSIVRALEHLHSKLSVIHRDVKPSNVLINKEGHVKMCDFGISGYLVDSVAKTMDAGCKPYMAPERINPELNQKGYNVKSDVWSLGITMIEMAILRFPYESWGTPFQQLKQVVEEPSPQLPADRFSPEFVDFTAQCLRKNPAERMSYLELMEHPFFTLHKTKKTDIAAFVKEILGEDS

Gene Information

• Gene Name: MAP2K3 mitogen-activated protein kinase kinase 3 [ Homo sapiens ]
• Official Symbol: MAP2K3
• Synonyms: MAP2K3; mitogen-activated protein kinase kinase 3; PRKMK3; dual specificity mitogen-activated protein kinase kinase 3; dual specificity mitogen activated protein kinase kinase 3; MAP kinase kinase 3; MAPK/ERK kinase 3; MAPKK3; MEK3; MKK3; MEK 3; MAPKK 3; SAPK kinase 2; stress-activated protein kinase kinase 2; SAPKK2; SAPKK-2
• Gene ID: 5606
• mRNA Refseq: NM_002756
• Protein Refseq: NP_002747
• MIM: 602315
• UniProt ID: P46734