Recombinant Human MAP1LC3B

• Cat.No.: MAP1LC3B-29219TH
• Product Overview: Recombinant full length Human LC3B expressed in Saccharomyces cerevisiae; 125 amino acids, MWt 14.7 kDa. The protein contains a tag, increasing its size to 40 kDa.

Specification

• Species: Human
• Tag: Non
• Description: The product of this gene is a subunit of neuronal microtubule-associated MAP1A and MAP1B proteins, which are involved in microtubule assembly and important for neurogenesis. Studies on the rat homolog implicate a role for this gene in autophagy, a process that involves the bulk degradation of cytoplasmic component.
• Form: Liquid
• Purity: >90% by SDS-PAGE
• Storage buffer: Preservative: NoneConstituents: 30% Glycerol, 0.5% Triton-X-100, 50mM HEPES, 30mM Glutathione, 100mM Sodium chloride, 1mM DTT, pH 7.5
• Storage: Shipped at 4°C. Upon delivery aliquot and store at -20°C. Avoid freeze / thaw cycles.
• Sequences of amino acids: MPSEKTFKQRRTFEQRVEDVRLIREQHPTKIPVIIERYKG EKQLPVLDKTKFLVPDHVNMSELIKIIRRRLQLNANQA FFLLVNGHSMVSVSTPISEVYESEKDEDGFLYMVYASQ ETFGMKLSV
• Full Length: Full L.

Gene Information

• Gene Name: MAP1LC3B microtubule-associated protein 1 light chain 3 beta [ Homo sapiens ]
• Official Symbol: MAP1LC3B
• Synonyms: MAP1LC3B; microtubule-associated protein 1 light chain 3 beta; microtubule-associated proteins 1A/1B light chain 3B; ATG8F
• Gene ID: 81631
• mRNA Refseq: NM_022818
• Protein Refseq: NP_073729
• MIM: 609604
• Uniprot ID: Q9GZQ8
• Chromosome Location: 16q24.2
• Pathway: Senescence and Autophagy, organism-specific biosystem
• Function: protein binding