Recombinant Human MANSC1, His-tagged
Cat.No. : | MANSC1-136H |
Product Overview : | Recombinant Human MANSC Domain-Containing Protein 1/MANSC1 is produced by our mammalian expression system in human cells. The target protein is expressed with sequence (Gln27-Leu385) of Human MANSC1 fused with a polyhistidine tag at the C-terminus. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | HEK293 |
Tag : | His |
Protein Length : | 27-385 a.a. |
AA Sequence : | QNCLKKSLEDVVIDIQSSLSKGIRGNEPIYTSTQEDCINSCCSTKNISGDKACNLMIFDTRKTAR QPNCYLFFCPNEEACPLKPAKGLMSYRIITDFPSLTRNLPSQELPQEDSLLHGQFSQAVTPLAHH HTDYSKPTDISWRDTLSQKFGSSDHLEKLFKMDEASAQLLAYKEKGHSQSSQFSSDQEIAHLLPE NVSALPATVAVASPHTTSATPKPATLLPTNASVTPSGTSQPQLATTAPPVTTVTSQPPTTLISTV FTRAAATLQAMATTAVLTTTFQAPTDSKGSLETIPFTEISNLTLNTGNVYNPTALSMSNVESSTM NKTASWEGREASPGSSSQGSVPENQYGLPFEKWLVDHHHHHH |
Endotoxin : | Less than 0.1 ng/μg (1 IEU/μg). |
Purity : | Greater than 95% as determined by SEC-HPLC and reducing SDS-PAGE. |
Gene Name | MANSC1 MANSC domain containing 1 [ Homo sapiens ] |
Official Symbol | MANSC1 |
Synonyms | MANSC1; MANSC domain containing 1; MANSC domain-containing protein 1; FLJ10298; LOH12CR3; loss of heterozygosity 12 chromosomal region 3 protein; 9130403P13Rik; |
Gene ID | 54682 |
mRNA Refseq | NM_018050 |
Protein Refseq | NP_060520 |
UniProt ID | Q9H8J5 |
Chromosome Location | 12p13.2 |
◆ Recombinant Proteins | ||
MANSC1-5347Z | Recombinant Zebrafish MANSC1 | +Inquiry |
MANSC1-9494M | Recombinant Mouse MANSC1 Protein | +Inquiry |
MANSC1-136H | Recombinant Human MANSC1, His-tagged | +Inquiry |
MANSC1-3032C | Recombinant Chicken MANSC1 | +Inquiry |
MANSC1-421C | Recombinant Cynomolgus Monkey MANSC1 Protein, His (Fc)-Avi-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
MANSC1-4518HCL | Recombinant Human MANSC1 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All MANSC1 Products
Required fields are marked with *
My Review for All MANSC1 Products
Required fields are marked with *
0
Inquiry Basket