Recombinant Human MAMLD1 Protein, GST-tagged

• Cat.No.: MAMLD1-2202H
• Product Overview: Human CXorf6 partial ORF ( NP_005482, 603 a.a. - 701 a.a.) recombinant protein with GST-tag at N-terminal.

Specification

• Species: Human
• Source: Wheat Germ
• Tag: GST
• Description: This gene encodes a mastermind-like domain containing protein. This protein may function as a transcriptional co-activator. Mutations in this gene are the cause of X-linked hypospadias type 2. Alternate splicing results in multiple transcript variants. [provided by RefSeq, Apr 2010]
• Molecular Mass: 36.63 kDa
• AA Sequence: SPSNITHVDKACKLGEARHPQVSLGRQPPSCQALGSESFLPGSSFAHELARVTSSYSTSEAAPWGSWDPKAWRQVPAPLLPSCDATARGTEIRSYGNDP
• Applications: Enzyme-linked Immunoabsorbent Assay
  Western Blot (Recombinant protein)
  Antibody Production
  Protein Array
• Notes: Best use within three months from the date of receipt of this protein.
• Storage: Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
• Storage Buffer: 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.

Gene Information

• Gene Name: MAMLD1 mastermind-like domain containing 1 [ Homo sapiens ]
• Official Symbol: MAMLD1
• Synonyms: MAMLD1; mastermind-like domain containing 1; chromosome X open reading frame 6 , CXorf6; mastermind-like domain-containing protein 1; CG1; F18; HYSP2; CXorf6
• Gene ID: 10046
• mRNA Refseq: NM_001177465
• Protein Refseq: NP_001170936
• MIM: 300120
• UniProt ID: Q13495