Recombinant Human MAL Protein, Myc/DDK-tagged, C13 and N15-labeled

• Cat.No.: MAL-3387H
• Product Overview: MAL MS Standard C13 and N15-labeled recombinant protein (NP_071885) with a C-terminal MYC/DDK tag, was expressed in HEK293 cells.

Specification

• Species: Human
• Source: HEK293
• Tag: Myc&DDK
• Description: The protein encoded by this gene is a highly hydrophobic integral membrane protein belonging to the MAL family of proteolipids. The protein has been localized to the endoplasmic reticulum of T-cells and is a candidate linker protein in T-cell signal transduction. In addition, this proteolipid is localized in compact myelin of cells in the nervous system and has been implicated in myelin biogenesis and/or function. The protein plays a role in the formation, stabilization and maintenance of glycosphingolipid-enriched membrane microdomains. Down-regulation of this gene has been associated with a variety of human epithelial malignancies. Alternative splicing produces four transcript variants which vary from each other by the presence or absence of alternatively spliced exons 2 and 3.
• Molecular Mass: 5.8 kDa
• AA Sequence: MAPAAATGGSTLPSGFSVFTTLPDLLFIFEFVFSYIATLLYVVHAVFSLIRWKSSTRTRPLEQKLISEEDLAANDILDYKDDDDKV
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Stability: Stable for 3 months from receipt of products under proper storage and handling conditions.
• Storage: Store at -80 centigrade. Avoid repeated freeze-thaw cycles.
• Concentration: 50 μg/mL as determined by BCA
• Storage Buffer: 100 mM glycine, 25 mM Tris-HCl, pH 7.3.

Gene Information

• Gene Name: MAL mal, T cell differentiation protein [ Homo sapiens (human) ]
• Official Symbol: MAL
• Synonyms: MAL; mal, T-cell differentiation protein; myelin and lymphocyte protein; T-cell differentiation protein MAL; T-lymphocyte maturation-associated protein
• Gene ID: 4118
• mRNA Refseq: NM_022440
• Protein Refseq: NP_071885
• MIM: 188860
• UniProt ID: P21145