Recombinant Human MAGEA8 protein, His&Myc-tagged
Cat.No. : | MAGEA8-755H |
Product Overview : | Recombinant Human MAGEA8 protein(P43361)(1-318aa), fused with N-terminal His tag and C-terminal Myc tag, was expressed in E.coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His&Myc |
Protein Length : | 1-318a.a. |
Tag : | His&Myc |
Form : | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
Molecular Mass : | 42.7 kDa |
Purity : | Greater than 85% as determined by SDS-PAGE. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. |
AA Sequence : | MLLGQKSQRYKAEEGLQAQGEAPGLMDVQIPTAEEQKAASSSSTLIMGTLEEVTDSGSPSPPQSPEGASSSLTVTDSTLWSQSDEGSSSNEEEGPSTSPDPAHLESLFREALDEKVAELVRFLLRKYQIKEPVTKAEMLESVIKNYKNHFPDIFSKASECMQVIFGIDVKEVDPAGHSYILVTCLGLSYDGLLGDDQSTPKTGLLIIVLGMILMEGSRAPEEAIWEALSVMGLYDGREHSVYWKLRKLLTQEWVQENYLEYRQAPGSDPVRYEFLWGPRALAETSYVKVLEHVVRVNARVRISYPSLHEEALGEEKGV |
Gene Name | MAGEA8 melanoma antigen family A, 8 [ Homo sapiens ] |
Official Symbol | MAGEA8 |
Synonyms | MAGEA8; melanoma antigen family A, 8; MAGE8; melanoma-associated antigen 8; cancer/testis antigen family 1; member 8; CT1.8; MAGE 8 antigen; MGC2182; MAGE-8 antigen; cancer/testis antigen 1.8; cancer/testis antigen family 1, member 8; |
Gene ID | 4107 |
mRNA Refseq | NM_001166400 |
Protein Refseq | NP_001159872 |
MIM | 300341 |
UniProt ID | P43361 |
◆ Recombinant Proteins | ||
MAGEA8-755H | Recombinant Human MAGEA8 protein, His&Myc-tagged | +Inquiry |
MAGEA8-1343H | Recombinant Human MAGEA8 Protein, His (Fc)-Avi-tagged | +Inquiry |
MAGEA8-28418TH | Recombinant Human MAGEA8, His-tagged | +Inquiry |
MAGEA8-1608HFL | Recombinant Full Length Human MAGEA8 Protein, C-Flag-tagged | +Inquiry |
MAGEA8-6754H | Recombinant Human MAGEA8 protein, His-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
MAGEA8-4550HCL | Recombinant Human MAGEA8 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All MAGEA8 Products
Required fields are marked with *
My Review for All MAGEA8 Products
Required fields are marked with *
0
Inquiry Basket