Recombinant Human MAGEA8 protein, His&Myc-tagged

• Cat.No.: MAGEA8-755H
• Product Overview: Recombinant Human MAGEA8 protein(P43361)(1-318aa), fused with N-terminal His tag and C-terminal Myc tag, was expressed in E.coli.

Specification

• Species: Human
• Source: E.coli
• Tag: His&Myc
• Protein Length: 1-318a.a.
• Tag: His&Myc
• Form: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
• Molecular Mass: 42.7 kDa
• Purity: Greater than 85% as determined by SDS-PAGE.
• Storage: Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
• Reconstitution: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C.
• AA Sequence: MLLGQKSQRYKAEEGLQAQGEAPGLMDVQIPTAEEQKAASSSSTLIMGTLEEVTDSGSPSPPQSPEGASSSLTVTDSTLWSQSDEGSSSNEEEGPSTSPDPAHLESLFREALDEKVAELVRFLLRKYQIKEPVTKAEMLESVIKNYKNHFPDIFSKASECMQVIFGIDVKEVDPAGHSYILVTCLGLSYDGLLGDDQSTPKTGLLIIVLGMILMEGSRAPEEAIWEALSVMGLYDGREHSVYWKLRKLLTQEWVQENYLEYRQAPGSDPVRYEFLWGPRALAETSYVKVLEHVVRVNARVRISYPSLHEEALGEEKGV

Gene Information

• Gene Name: MAGEA8 melanoma antigen family A, 8 [ Homo sapiens ]
• Official Symbol: MAGEA8
• Synonyms: MAGEA8; melanoma antigen family A, 8; MAGE8; melanoma-associated antigen 8; cancer/testis antigen family 1; member 8; CT1.8; MAGE 8 antigen; MGC2182; MAGE-8 antigen; cancer/testis antigen 1.8; cancer/testis antigen family 1, member 8
• Gene ID: 4107
• mRNA Refseq: NM_001166400
• Protein Refseq: NP_001159872
• MIM: 300341
• UniProt ID: P43361