Recombinant Human LZIC Protein, Myc/DDK-tagged, C13 and N15-labeled

Cat.No. : LZIC-1623H
Product Overview : LZIC MS Standard C13 and N15-labeled recombinant protein (NP_115744) with a C-terminal MYC/DDK tag, was expressed in HEK293 cells.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : HEK293
Tag : Myc&DDK
Description : Belongs to the CTNNBIP1 family.
Molecular Mass : 21.5 kDa
AA Sequence : MASRGKTETSKLKQNLEEQLDRLMQQLQDLEECREELDTDEYEETKKETLEQLSEFNDSLKKIMSGNMTLVDELSGMQLAIQAAISQAFKTPEVIRLFAKKQPGQLRTRLAEMDRDLMVGKLERDLYTQQKVEILTALRKLGEKLTADDEAFLSANAGAILSQFEKVSTDLGSGDKILALASFEVEKTKKTRTRPLEQKLISEEDLAANDILDYKDDDDKV
Purity : > 80% as determined by SDS-PAGE and Coomassie blue staining
Stability : Stable for 3 months from receipt of products under proper storage and handling conditions.
Storage : Store at -80 centigrade. Avoid repeated freeze-thaw cycles.
Concentration : 50 μg/mL as determined by BCA
Storage Buffer : 100 mM glycine, 25 mM Tris-HCl, pH 7.3.
Gene Name LZIC leucine zipper and CTNNBIP1 domain containing [ Homo sapiens (human) ]
Official Symbol LZIC
Synonyms LZIC; leucine zipper and CTNNBIP1 domain containing; protein LZIC; MGC15436; leucine zipper and CTNNBIP1 domain-containing protein; leucine zipper domain and ICAT homologous domain containing; leucine zipper and ICAT homologous domain-containing protein;
Gene ID 84328
mRNA Refseq NM_032368
Protein Refseq NP_115744
MIM 610458
UniProt ID Q8WZA0

Not For Human Consumption!

Inquiry

  • Reviews
  • Q&As

Customer Reviews (0)

Write a review

Q&As (0)

Ask a question

Ask a Question for All LZIC Products

Required fields are marked with *

My Review for All LZIC Products

Required fields are marked with *

0

Inquiry Basket

cartIcon