Recombinant Human LZIC Protein, Myc/DDK-tagged, C13 and N15-labeled

• Cat.No.: LZIC-1623H
• Product Overview: LZIC MS Standard C13 and N15-labeled recombinant protein (NP_115744) with a C-terminal MYC/DDK tag, was expressed in HEK293 cells.

Specification

• Species: Human
• Source: HEK293
• Tag: Myc&DDK
• Description: Belongs to the CTNNBIP1 family.
• Molecular Mass: 21.5 kDa
• AA Sequence: MASRGKTETSKLKQNLEEQLDRLMQQLQDLEECREELDTDEYEETKKETLEQLSEFNDSLKKIMSGNMTLVDELSGMQLAIQAAISQAFKTPEVIRLFAKKQPGQLRTRLAEMDRDLMVGKLERDLYTQQKVEILTALRKLGEKLTADDEAFLSANAGAILSQFEKVSTDLGSGDKILALASFEVEKTKKTRTRPLEQKLISEEDLAANDILDYKDDDDKV
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Stability: Stable for 3 months from receipt of products under proper storage and handling conditions.
• Storage: Store at -80 centigrade. Avoid repeated freeze-thaw cycles.
• Concentration: 50 μg/mL as determined by BCA
• Storage Buffer: 100 mM glycine, 25 mM Tris-HCl, pH 7.3.

Gene Information

• Gene Name: LZIC leucine zipper and CTNNBIP1 domain containing [ Homo sapiens (human) ]
• Official Symbol: LZIC
• Synonyms: LZIC; leucine zipper and CTNNBIP1 domain containing; protein LZIC; MGC15436; leucine zipper and CTNNBIP1 domain-containing protein; leucine zipper domain and ICAT homologous domain containing; leucine zipper and ICAT homologous domain-containing protein
• Gene ID: 84328
• mRNA Refseq: NM_032368
• Protein Refseq: NP_115744
• MIM: 610458
• UniProt ID: Q8WZA0