Recombinant Human LYRM7 Protein, GST-tagged

• Cat.No.: LYRM7-4538H
• Product Overview: Human LYRM7 full-length ORF (1 a.a. - 104 a.a.) recombinant protein with GST-tag at N-terminal.

Specification

• Species: Human
• Source: Wheat Germ
• Tag: GST
• Description: Inner mitochondrial membrane complex III (CIII) is the main enzyme complex in the mitochondrial respiratory chain, and Rieske Fe-S protein (UQCRFS1) is the last catalytic subunit added to the complex. The protein encoded by this gene is a nuclear-encoded mitochondrial matrix protein that stabilizes UQCRFS1 and chaperones it to the CIII complex. Defects in this gene are a cause of mitochondrial complex III deficiency, nuclear type 8. Three transcript variants encoding two different isoforms have been found for this gene. [provided by RefSeq, Jun 2014]
• Molecular Mass: 37.84 kDa
• AA Sequence: MGRAVKVLQLFKTLHRTRQQVFKNDARALEAARIKINEEFKNNKSETSSKKIEELMKIGSDVELLLRTSVIQGIHTDHNTLKLVPRKDLLVENVPYCDAPTQKQ
• Applications: Enzyme-linked Immunoabsorbent Assay
  Western Blot (Recombinant protein)
  Antibody Production
  Protein Array
• Notes: Best use within three months from the date of receipt of this protein.
• Storage: Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
• Storage Buffer: 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.

Gene Information

• Gene Name: LYRM7 LYR motif containing 7 [ Homo sapiens (human) ]
• Official Symbol: LYRM7
• Synonyms: LYRM7; LYR motif containing 7; MZM1L; MC3DN8; C5orf31; complex III assembly factor LYRM7; LYR motif-containing protein 7; Lyrm7 homolog
• Gene ID: https://www.ncbi.nlm.nih.gov/gene/?term=90624
• mRNA Refseq: NM_001293735
• Protein Refseq: NP_001280664
• MIM: 615831
• UniProt ID: Q5U5X0