Recombinant Human LYPLAL1 Protein, GST-tagged

• Cat.No.: LYPLAL1-4543H
• Product Overview: Human LYPLAL1 full-length ORF ( NP_620149.1, 1 a.a. - 237 a.a.) recombinant protein with GST-tag at N-terminal.

Specification

• Species: Human
• Source: Wheat Germ
• Tag: GST
• Description: LYPLAL1 (Lysophospholipase Like 1) is a Protein Coding gene. Diseases associated with LYPLAL1 include Peters Anomaly. GO annotations related to this gene include hydrolase activity and lysophospholipase activity. An important paralog of this gene is LYPLA1.
• Molecular Mass: 52.7 kDa
• AA Sequence: MAAASGSVLQRCIVSPAGRHSASLIFLHGSGDSGQGLRMWIKQVLNQDLTFQHIKIIYPTAPPRSYTPMKGGISNVWFDRFKITNDCPEHLESIDVMCQVLTDLIDEEVKSGIKKNRILIGGFSMGGCMAMHLAYRNHQDVAGVFALSSFLNKASAVYQALQKSNGVLPELFQCHGTADELVLHSWAEETNSMLKSLGVTTKFHSFPNVYHELSKTELDILKLWILTKLPGEMEKQK
• Applications: Enzyme-linked Immunoabsorbent Assay
  Western Blot (Recombinant protein)
  Antibody Production
  Protein Array
• Notes: Best use within three months from the date of receipt of this protein.
• Storage: Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
• Storage Buffer: 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.

Gene Information

• Gene Name: LYPLAL1 lysophospholipase-like 1 [ Homo sapiens ]
• Official Symbol: LYPLAL1
• Synonyms: LYPLAL1; lysophospholipase-like 1; lysophospholipase-like protein 1; Q96AV0; FLJ99730; KIAA1238
• Gene ID: 127018
• mRNA Refseq: NM_138794
• Protein Refseq: NP_620149
• UniProt ID: Q5VWZ2