Recombinant Human LYN

• Cat.No.: LYN-28760TH
• Product Overview: Recombinant fragment: MGCIKSKGKD SLSDDGVDLK TQPVRNTERT IYVRDPTSNK QQRPVPESQL LPGQRFQTKD PEEQGDIVVA LYPYDGIHPD DLSFKKGEKM KVLEEHGEWW, corresponding to amino acids 1-100 of Human Lyn with proprietary tag; 37kDa.

Specification

• Species: Human
• Source: E.coli
• Tag: Non
• Protein Length: 1-100 a.a.
• Description: This gene encodes a tyrosine protein kinase, which maybe involved in the regulation of mast cell degranulation, and erythroid differentiation. Alternatively spliced transcript variants encoding different isoforms have been found for this gene.
• Tissue specificity: Widely expressed in a variety of organs, tissues, and cell types such as epidermoid, hematopoietic, and neuronal cells. Expressed in primary neuroblastoma tumors.
• Form: Liquid
• Storage buffer: Preservative: NoneConstituents: 20% Glycerol, 50mM Tris acetate, 1mM EDTA, pH 7.5
• Storage: Shipped at 4°C. Upon delivery aliquot and store at -20°C or -80°C. Avoid repeated freeze / thaw cycles.
• Sequences of amino acids: MGCIKSKGKDSLSDDGVDLKTQPVRNTERTIYVRDPTSNKQQRPVPESQLLPGQRFQTKDPEEQGDIVVALYPYDGIHPDDLSFKKGEKMKVLEEHGEWW
• Sequence Similarities: Belongs to the protein kinase superfamily. Tyr protein kinase family. SRC subfamily.Contains 1 protein kinase domain.Contains 1 SH2 domain.Contains 1 SH3 domain.

Gene Information

• Gene Name: LYN v-yes-1 Yamaguchi sarcoma viral related oncogene homolog [ Homo sapiens ]
• Official Symbol: LYN
• Synonyms: LYN; v-yes-1 Yamaguchi sarcoma viral related oncogene homolog; tyrosine-protein kinase Lyn; JTK8
• Gene ID: 4067
• mRNA Refseq: NM_001111097
• Protein Refseq: NP_001104567
• MIM: 165120
• Uniprot ID: P07948
• Chromosome Location: 8q13
• Pathway: Adaptive Immune System, organism-specific biosystem; Alpha-synuclein signaling, organism-specific biosystem; B Cell Receptor Signaling Pathway, organism-specific biosystem; B cell receptor signaling pathway, organism-specific biosystem; B cell receptor signaling pathway, conserved biosystem
• Function: ATP binding; SH3 domain binding; glycosphingolipid binding; integrin binding; ion channel binding