Recombinant Human LYL1 Protein, GST-tagged

Cat.No. : LYL1-4558H
Product Overview : Human LYL1 full-length ORF (AAH02796.2, 1 a.a. - 280 a.a.) recombinant protein with GST-tag at N-terminal.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : Wheat Germ
Tag : GST
Description : This gene represents a basic helix-loop-helix transcription factor. The encoded protein may play roles in blood vessel maturation and hematopoeisis. A translocation between this locus and the T cell receptor beta locus (GeneID 6957) on chromosome 7 has been associated with acute lymphoblastic leukemia. [provided by RefSeq, Sep 2010]
Molecular Mass : 57.2 kDa
AA Sequence : MCPPQAQAEVGPTMTEKAEMVCAPSPAPAPPPKPASPGPPQVEEVGHRGGSSPPRLPPGVPVISLGHSRPPGVAMPTTELGTLRPPLLQLSTLGTAPPTLALHYHPHPFLNSVYIGPAGPFSIFPSSRLKRRPSHCELDLAEGHQPQKVARRVFTNSRERWRQQNVNGAFAELRKLLPTHPPDRKLSKNEVLRLAMKYIGFLVRLLRDQAAALAAGPTPPGPRKRPVHRVPDDGARRGSGRRAEAAARSQPAPPADPDGSPGGAARPIKMEQTALSPEVR
Applications : Enzyme-linked Immunoabsorbent Assay
Western Blot (Recombinant protein)
Antibody Production
Protein Array
Notes : Best use within three months from the date of receipt of this protein.
Storage : Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
Storage Buffer : 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Gene Name LYL1 lymphoblastic leukemia derived sequence 1 [ Homo sapiens ]
Official Symbol LYL1
Synonyms LYL1; lymphoblastic leukemia derived sequence 1; protein lyl-1; bHLHa18; class A basic helix-loop-helix protein 18;
Gene ID 4066
mRNA Refseq NM_005583
Protein Refseq NP_005574
MIM 151440
UniProt ID P12980

Not For Human Consumption!

Inquiry

  • Reviews
  • Q&As

Customer Reviews (0)

Write a review

Q&As (0)

Ask a question

Ask a Question for All LYL1 Products

Required fields are marked with *

My Review for All LYL1 Products

Required fields are marked with *

0

Inquiry Basket

cartIcon