Recombinant Full Length Human LY96 Protein, C-Flag-tagged

• Cat.No.: LY96-1707HFL
• Product Overview: Recombinant Full Length Human LY96 Protein, fused to Flag-tag at C-terminus, was expressed in Mammalian cells.

Specification

• Species: Human
• Source: Mammalian Cells
• Tag: Flag
• Description: This gene encodes a protein which associates with toll-like receptor 4 on the cell surface and confers responsiveness to lipopolysaccyaride (LPS), thus providing a link between the receptor and LPS signaling. Studies of the mouse ortholog suggest that this gene may be involved in endotoxin neutralization. Alternative splicing results in multiple transcript variants encoding different isoforms.
• Form: 25 mM Tris HCl, pH 7.3, 100 mM glycine, 10% glycerol.
• Molecular Mass: 18.4 kDa
• AA Sequence: MLPFLFFSTLFSSIFTEAQKQYWVCNSSDASISYTYCDKMQYPISINVNPCIELKGSKGLLHIFYIPRRD LKQLYFNLYITVNTMNLPKRKEVICRGSDDDYSFCRALKGETVNTTISFSFKGIKFSKGKYKCVVEAISG
  SPEEMLFCLEFVILHQPNSNTRTRPLEQKLISEEDLAANDILDYKDDDDKV
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining.
• Stability: Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.
• Storage: Store at -80 centigrade.
• Concentration: >50 ug/mL as determined by microplate BCA method.
• Preparation: Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps.
• Protein Families: Secreted Protein
• Protein Pathways: Pathogenic Escherichia coli infection, Toll-like receptor signaling pathway
• Full Length: Full L.

Gene Information

• Gene Name: LY96 lymphocyte antigen 96 [ Homo sapiens (human) ]
• Official Symbol: LY96
• Synonyms: MD2; MD-2; ly-96; ESOP-1
• Gene ID: 23643
• mRNA Refseq: NM_015364.5
• Protein Refseq: NP_056179.4
• MIM: 605243
• UniProt ID: Q9Y6Y9