Recombinant Human LY6E Protein, GST-tagged

• Cat.No.: LY6E-4570H
• Product Overview: Human LY6E full-length ORF ( NP_002337.1, 1 a.a. - 131 a.a.) recombinant protein with GST-tag at N-terminal.

Specification

• Description: LY6E (Lymphocyte Antigen 6 Family Member E) is a Protein Coding gene. Diseases associated with LY6E include Leukemia, Acute Promyelocytic, Somatic. Among its related pathways are Post-translational modification- synthesis of GPI-anchored proteins and Metabolism of proteins.
• Source: Wheat Germ
• Species: Human
• Tag: GST
• Molecular Mass: 39.9 kDa
• AA Sequence: MKIFLPVLLAALLGVERASSLMCFSCLNQKSNLYCLKPTICSDQDNYCVTVSASAGIGNLVTFGHSLSKTCSPACPIPEGVNVGVASMGISCCQSFLCNFSAADGGLRASVTLLGAGLLLSLLPALLRFGP
• Applications: Enzyme-linked Immunoabsorbent Assay
  Western Blot (Recombinant protein)
  Antibody Production
  Protein Array
• Notes: Best use within three months from the date of receipt of this protein.
• Storage: Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
• Storage Buffer: 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.

Gene Information

• Gene Name: LY6E lymphocyte antigen 6 complex, locus E [ Homo sapiens ]
• Official Symbol: LY6E
• Synonyms: LY6E; lymphocyte antigen 6 complex, locus E; lymphocyte antigen 6E; retinoic acid induced gene E; RIG E; SCA 2; TSA 1; ly-6E; stem cell antigen 2; thymic shared antigen 1; retinoic acid-induced gene E protein; RIGE; SCA2; RIG-E; SCA-2; TSA-1
• Gene ID: 4061
• mRNA Refseq: NM_001127213
• Protein Refseq: NP_001120685
• MIM: 601384
• UniProt ID: Q16553