Recombinant Mouse Ly6e protein, His&Myc-tagged

Cat.No. : Ly6e-4511M
Product Overview : Recombinant Mouse Ly6e protein(Q64253)(21-102aa), fused to N-terminal His tag and C-terminal Myc tag, was expressed in E. coli
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Mouse
Source : E.coli
Tag : His&Myc
Protein Length : 21-102aa
Form : If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol.
If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Molecular Mass : 13.8 kDa
AA Sequence : LMCFSCTDQKNNINCLWPVSCQEKDHYCITLSAAAGFGNVNLGYTLNKGCSPICPSENVNLNLGVASVNSYCCQSSFCNFSA
Purity : Greater than 90% as determined by SDS-PAGE.
Storage : Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Reconstitution : Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%.
Gene Name Ly6e lymphocyte antigen 6 complex, locus E [ Mus musculus ]
Official Symbol Ly6e
Synonyms LY6E; lymphocyte antigen 6 complex, locus E; lymphocyte antigen 6E; ly-6E; stem cell antigen 2; thymic shared antigen 1; 9804; Ly67; Tsa1; RIG-E; Sca-2; TSA-1;
Gene ID 17069
mRNA Refseq NM_001164036
Protein Refseq NP_001157508

Not For Human Consumption!

Inquiry

  • Reviews
  • Q&As

Customer Reviews (0)

Write a review

Q&As (0)

Ask a question

Ask a Question for All Ly6e Products

Required fields are marked with *

My Review for All Ly6e Products

Required fields are marked with *

0

Inquiry Basket

cartIcon