Recombinant Mouse Ly6e protein, His&Myc-tagged

• Cat.No.: Ly6e-4511M
• Product Overview: Recombinant Mouse Ly6e protein(Q64253)(21-102aa), fused to N-terminal His tag and C-terminal Myc tag, was expressed in E. coli

Specification

• Species: Mouse
• Source: E.coli
• Tag: His&Myc
• Protein Length: 21-102aa
• Form: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol.
  If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
• Molecular Mass: 13.8 kDa
• AA Sequence: LMCFSCTDQKNNINCLWPVSCQEKDHYCITLSAAAGFGNVNLGYTLNKGCSPICPSENVNLNLGVASVNSYCCQSSFCNFSA
• Purity: Greater than 90% as determined by SDS-PAGE.
• Storage: Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
• Reconstitution: Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%.

Gene Information

• Gene Name: Ly6e lymphocyte antigen 6 complex, locus E [ Mus musculus ]
• Official Symbol: Ly6e
• Synonyms: LY6E; lymphocyte antigen 6 complex, locus E; lymphocyte antigen 6E; ly-6E; stem cell antigen 2; thymic shared antigen 1; 9804; Ly67; Tsa1; RIG-E; Sca-2; TSA-1
• Gene ID: 17069
• mRNA Refseq: NM_001164036
• Protein Refseq: NP_001157508