Recombinant Human LTBR Protein, Fc-tagged
Cat.No. : | LTBR-369H |
Product Overview : | Recombinant human LTBR protein with Fc tag was expressed in HEK293. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | HEK293 |
Tag : | Fc |
Protein Length : | 435 |
Description : | This gene encodes a member of the tumor necrosis factor receptor superfamily. The major ligands of this receptor include lymphotoxin alpha/beta and tumor necrosis factor ligand superfamily member 14. The encoded protein plays a role in signalling during the development of lymphoid and other organs, lipid metabolism, immune response, and programmed cell death. Activity of this receptor has also been linked to carcinogenesis. Alternatively spliced transcript variants encoding multiple isoforms have been observed. |
Form : | Lyophilized |
Molecular Mass : | 48.4 kDa |
AA Sequence : | MLLPWATSAPGLAWGPLVLGLFGLLAASQPQAVPPYASENQTCRDQEKEYYEPQHRICCSRCPPGTYVSAKCSRIRDTVCATCAENSYNEHWNYLTICQLCRPCDPVMGLEEIAPCTSKRKTQCRCQPGMFCAAWALECTHCELLSDCPPGTEAELKDEVGKGNNHCVPCKAGHFQNTSSPSARCQPHTRCENQGLVEAAPGTAQSDTTCKNPLEPLPPEMSGTMLMLAVLLPLAFFLLLATVFSCIWKSHPSLCRKLGSLLKRRPQGEGPNPVAGSWEPPKAHPYFPDLVQPLLPISGDVSPVSTGLPAAPVLEAGVPQQQSPLDLTREPQLEPGEQSQVAHGTNGIHVTGGSMTITGNIYIYNGPVLGGPPGPGDLPATPEPPYPIPEEGDPGPPGLSTPHQEDGKAWHLAETEHCGATPSNRGPRNQFITHD |
Purity : | > 98% |
Applications : | WB; ELISA; FACS; FC |
Stability : | This bioreagent is stable at 4 centigrade (short-term) and -70 centigrade(long-term). After reconstitution, sample may be stored at 4 centigrade for 2-7 days and below -18 centigrade for future use. |
Storage : | At -20 centigrade. |
Concentration : | 1 mg/mL |
Storage Buffer : | PBS (pH 7.4-7.5). Sterile-filtered colorless solution. |
Reconstitution : | Reconstitute in sterile distilled H2O to no less than 100 μg/mL; dilute reconstituted stock further in other aqueous solutions if needed. Please review COA for lot-specific instructions. Final measurements should be determined by the end-user for optimal performance. |
Gene Name | LTBR lymphotoxin beta receptor (TNFR superfamily, member 3) [ Homo sapiens (human) ] |
Official Symbol | LTBR |
Synonyms | LTBR; lymphotoxin beta receptor (TNFR superfamily, member 3); D12S370; tumor necrosis factor receptor superfamily member 3; TNF R III; TNFCR; TNFR RP; TNFR2 RP; TNFRSF3; TNF-RIII; TNFR-III; lymphotoxin B receptor; lymphotoxin-beta receptor; TNFR superfamily, member 3; tumor necrosis factor C receptor; tumor necrosis factor receptor type III; tumor necrosis factor receptor 2-related protein; tumor necrosis factor receptor superfamily, member 3; CD18; TNFR-RP; TNFR2-RP; LT-BETA-R; TNF-R-III; |
Gene ID | 4055 |
mRNA Refseq | NM_002342 |
Protein Refseq | NP_002333 |
MIM | 600979 |
UniProt ID | P36941 |
◆ Recombinant Proteins | ||
Ltbr-2684M | Recombinant Mouse Ltbr protein, His & GST-tagged | +Inquiry |
LTBR-1840H | Recombinant Human LTBR protein, His-tagged, PE Labeled | +Inquiry |
LTBR-635H | Active Recombinant Human LTBR protein, Fc-tagged | +Inquiry |
LTBR-2683H | Recombinant Human LTBR protein, His-tagged | +Inquiry |
LTBR-960H | Recombinant Human LTBR Protein, His-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
LTBR-1229CCL | Recombinant Cynomolgus LTBR cell lysate | +Inquiry |
LTBR-1052RCL | Recombinant Rat LTBR cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All LTBR Products
Required fields are marked with *
My Review for All LTBR Products
Required fields are marked with *
0
Inquiry Basket