Recombinant Human LSM6 Protein, Myc/DDK-tagged, C13 and N15-labeled

Cat.No. : LSM6-4654H
Product Overview : LSM6 MS Standard C13 and N15-labeled recombinant protein (NP_009011) with a C-terminal MYC/DDK tag, was expressed in HEK293 cells.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : HEK293
Tag : DDK&Myc
Description : Sm-like proteins were identified in a variety of organisms based on sequence homology with the Sm protein family. Sm-like proteins contain the Sm sequence motif, which consists of 2 regions separated by a linker of variable length that folds as a loop. The Sm-like proteins are thought to form a stable heteromer present in tri-snRNP particles, which are important for pre-mRNA splicing.
Molecular Mass : 9.1 kDa
AA Sequence : MSLRKQTPSDFLKQIIGRPVVVKLNSGVDYRGVLACLDGYMNIALEQTEEYVNGQLKNKYGDAFIRGNNVLYISTQKRRMTRTRPLEQKLISEEDLAANDILDYKDDDDKV
Purity : > 80% as determined by SDS-PAGE and Coomassie blue staining
Stability : Stable for 3 months from receipt of products under proper storage and handling conditions.
Storage : Store at -80 centigrade. Avoid repeated freeze-thaw cycles.
Concentration : 50 μg/mL as determined by BCA
Storage Buffer : 100 mM glycine, 25 mM Tris-HCl, pH 7.3.
Gene Name LSM6 LSM6 homolog, U6 small nuclear RNA and mRNA degradation associated [ Homo sapiens (human) ]
Official Symbol LSM6
Synonyms LSM6; LSM6 homolog, U6 small nuclear RNA associated (S. cerevisiae); U6 snRNA-associated Sm-like protein LSm6; YDR378C; Sm protein F;
Gene ID 11157
mRNA Refseq NM_007080
Protein Refseq NP_009011
MIM 607286
UniProt ID P62312

Not For Human Consumption!

Inquiry

  • Reviews
  • Q&As

Customer Reviews (0)

Write a review

Q&As (0)

Ask a question

Ask a Question for All LSM6 Products

Required fields are marked with *

My Review for All LSM6 Products

Required fields are marked with *

0

Inquiry Basket

cartIcon