Recombinant Human LSM10 Protein (1-123 aa), His-SUMO-tagged

• Cat.No.: LSM10-1073H
• Product Overview: Recombinant Human LSM10 Protein (1-123 aa) is produced by E. coli expression system. This protein is fused with a 6xHis-SUMO tag at the N-terminal. Research Area: Transcription. Protein Description: Full Length.

Specification

• Species: Human
• Source: E.coli
• Tag: His&SUMO
• ProteinLength: 1-123 aa
• Description: Appears to function in the U7 snRNP complex that is involved in histone 3'-end processing. Increases U7 snRNA levels but not histone 3'-end pre-mRNA processing activity, when overexpressed. Required for cell cycle progression from G1 to S phases. Binds specifically to U7 snRNA. Binds to the downstream cleavage product (DCP) of histone pre-mRNA in a U7 snRNP dependent manner.
• Form: Tris-based buffer, 50% glycerol
• Molecular Mass: 30.1 kDa
• AA Sequence: MAVSHSVKERTISENSLIILLQGLQGRVTTVDLRDESVAHGRIDNVDAFMNIRLAKVTYTDRWGHQVKLDDLFVTGRNVRYVHIPDDVNITSTIEQQLQIIHRVRNFGGKGQGRWEFPPKNCK
• Purity: > 90% as determined by SDS-PAGE.
• Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4 centigrade for up to one week.
• Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20 centigrade/-80 centigrade. The shelf life of lyophilized form is 12 months at -20 centigrade/-80 centigrade.
• Concentration: A hardcopy of COA with concentration instruction is sent along with the products.

Gene Information

• Gene Name: LSM10 LSM10, U7 small nuclear RNA associated [ Homo sapiens ]
• Official Symbol: LSM10
• Synonyms: LSM10; MGC15749; MST074; MSTP074
• Gene ID: 84967
• mRNA Refseq: NM_032881
• Protein Refseq: NP_116270
• UniProt ID: Q969L4