Recombinant Human LRRTM1 Protein

• Cat.No.: LRRTM1-4628H
• Product Overview: Human LRRTM1 full-length ORF (ADR82640.1) recombinant protein without tag.

Specification

• Species: Human
• Source: Wheat Germ
• Tag: Non
• Description: LRRTM1 (Leucine Rich Repeat Transmembrane Neuronal 1) is a Protein Coding gene. Diseases associated with LRRTM1 include Schizophrenia and Autism Spectrum Disorder. Among its related pathways are Protein-protein interactions at synapses and Transmission across Chemical Synapses. An important paralog of this gene is LRRTM2.
• Form: Liquid
• Molecular Mass: 57.5 kDa
• AA Sequence: MDFLLLGLCLYWLLRRPSGVVLCLLGACFQMLPAAPSGCPQLCRCEGRLLYCEALNLTEAPHNLSGLLGLSLRYNSLSELRAGQFTGLMQLTWLYLDHNHICSVQGDAFQKLRRVKELTLSSNQITQLPNTTFRPMPNLRSVDLSYNKLQALAPDLFHGLRKLTTLHMRANAIQFVPVRIFQDCRSLKFLDIGYNQLKSLARNSFAGLFKLTELHLEHNDLVKVNFAHFPRLISLHSLCLRRNKVAIVVSSLDWVWNLEKMDLSGNEIEYMEPHVFETVPHLQSLQLDSNRLTYIEPRILNSWKSLTSITLAGNLWDCGRNVCALASWLSNFQGRYDGNLQCASPEYAQGEDVLDAVYAFHLCEDGAEPTSGHLLSAVTNRSDLGPPASSATTLADGGEGQHDGTFEPATVALPGGEHAENAVQIHKVVTGTMALIFSFLIVVLVLYVSWKCFPASLRQLRQCFVTQRRKQKQKQTMHQMAAMSAQEYYVDYKPNHIEGALVIINEYGSCTCHQQPARECEV
• Applications: Antibody Production
  Functional Study
  Compound Screening
• Usage: Heating may cause protein aggregation. Please do not heat this product before electrophoresis.
• Notes: Best use within three months from the date of receipt of this protein.
• Storage: Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
• Storage Buffer: 25 mM Tris-HCl of pH8.0 containing 2% glycerol.

Gene Information

• Gene Name: LRRTM1 leucine rich repeat transmembrane neuronal 1 [ Homo sapiens ]
• Official Symbol: LRRTM1
• Synonyms: LRRTM1; leucine rich repeat transmembrane neuronal 1; leucine-rich repeat transmembrane neuronal protein 1; FLJ32082; leucine-rich repeat transmembrane neuronal 1 protein
• Gene ID: 347730
• mRNA Refseq: NM_178839
• Protein Refseq: NP_849161
• MIM: 610867
• UniProt ID: Q86UE6