Recombinant Human LRRIQ3 Protein, GST-tagged

• Cat.No.: LRRIQ3-4663H
• Product Overview: Human LRRC44 full-length ORF ( NP_660301.1, 1 a.a. - 199 a.a.) recombinant protein with GST-tag at N-terminal.

Specification

• Species: Human
• Source: Wheat Germ
• Tag: GST
• Description: LRRIQ3 (Leucine Rich Repeats And IQ Motif Containing 3) is a Protein Coding gene.
• Molecular Mass: 49.6 kDa
• AA Sequence: MFHGTVTEELTSHEEWSHYNENIREGQKDFVFVKFNGLHLKSMENLQSCISLRVCIFSNNFITDIHPLQSCIKLIKLDLHGNQIKSLPNTKFWNGLKNLKLLYLHDNGFAKLKNICVLSACPTLIALTMFDCPVSLKKGYRHVLVNSIWPLKALDHHVISDEEIIQNWHLPERFKACNHRLFFNFCPALRKEKMKHSEV
• Applications: Enzyme-linked Immunoabsorbent Assay
  Western Blot (Recombinant protein)
  Antibody Production
  Protein Array
• Notes: Best use within three months from the date of receipt of this protein.
• Storage: Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
• Storage Buffer: 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.

Gene Information

• Gene Name: LRRIQ3 leucine rich repeats and IQ motif containing 3 [ Homo sapiens (human) ]
• Official Symbol: LRRIQ3
• Synonyms: LRRIQ3; leucine rich repeats and IQ motif containing 3; LRRC44; leucine-rich repeat and IQ domain-containing protein 3; leucine rich repeat containing 44; leucine-rich repeat-containing protein 44
• Gene ID: 127255
• mRNA Refseq: NM_001105659
• Protein Refseq: NP_001099129
• UniProt ID: A6PVS8