Recombinant Human LRRFIP1 Protein, GST-tagged

Description :	LRRFIP1 (LRR Binding FLII Interacting Protein 1) is a Protein Coding gene. Diseases associated with LRRFIP1 include Gingival Recession. Among its related pathways are Innate Immune System and FGFR1 mutant receptor activation. GO annotations related to this gene include protein homodimerization activity and double-stranded RNA binding. An important paralog of this gene is LRRFIP2.
Source :	Wheat Germ
Species :	Human
Tag :	GST
Molecular Mass :	37.29 kDa
AA Sequence :	MHVMDLQRDANRQISDLKFKLAKSEQEITALEQNVIRLESQVSRYKSAAENAEKIEDELKAEKRKLQRELRSALDKTEELEVSNGHLVKRLEKMKANRSALLSQQ
Applications :	Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array
Notes :	Best use within three months from the date of receipt of this protein.
Storage :	Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
Storage Buffer :	50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.

Gene Name	LRRFIP1 leucine rich repeat (in FLII) interacting protein 1 [ Homo sapiens ]
Official Symbol	LRRFIP1
Synonyms	LRRFIP1; leucine rich repeat (in FLII) interacting protein 1; leucine-rich repeat flightless-interacting protein 1; FLAP 1; FLIIAP1; GC binding factor 2; GCF 2; HUFI 1; TRIP; GC-binding factor 2; NEDD8-conjugating enzyme; TAR RNA-interacting protein; LRR FLII-interacting protein 1; GCF2; FLAP1; GCF-2; FLAP-1; HUFI-1; MGC10947; MGC119738; MGC119739;
Gene ID	9208
mRNA Refseq	NM_001137550
Protein Refseq	NP_001131022
MIM	603256
UniProt ID	Q32MZ4