Recombinant Human LRRFIP1 Protein, GST-tagged

• Cat.No.: LRRFIP1-4643H
• Product Overview: Human LRRFIP1 full-length ORF ( AAH10662, 1 a.a. - 105 a.a.) recombinant protein with GST-tag at N-terminal.

Specification

• Species: Human
• Source: Wheat Germ
• Tag: GST
• Description: LRRFIP1 (LRR Binding FLII Interacting Protein 1) is a Protein Coding gene. Diseases associated with LRRFIP1 include Gingival Recession. Among its related pathways are Innate Immune System and FGFR1 mutant receptor activation. GO annotations related to this gene include protein homodimerization activity and double-stranded RNA binding. An important paralog of this gene is LRRFIP2.
• Molecular Mass: 37.29 kDa
• AA Sequence: MHVMDLQRDANRQISDLKFKLAKSEQEITALEQNVIRLESQVSRYKSAAENAEKIEDELKAEKRKLQRELRSALDKTEELEVSNGHLVKRLEKMKANRSALLSQQ
• Applications: Enzyme-linked Immunoabsorbent Assay
  Western Blot (Recombinant protein)
  Antibody Production
  Protein Array
• Notes: Best use within three months from the date of receipt of this protein.
• Storage: Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
• Storage Buffer: 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.

Gene Information

• Gene Name: LRRFIP1 leucine rich repeat (in FLII) interacting protein 1 [ Homo sapiens ]
• Official Symbol: LRRFIP1
• Synonyms: LRRFIP1; leucine rich repeat (in FLII) interacting protein 1; leucine-rich repeat flightless-interacting protein 1; FLAP 1; FLIIAP1; GC binding factor 2; GCF 2; HUFI 1; TRIP; GC-binding factor 2; NEDD8-conjugating enzyme; TAR RNA-interacting protein; LRR FLII-interacting protein 1; GCF2; FLAP1; GCF-2; FLAP-1; HUFI-1; MGC10947; MGC119738; MGC119739
• Gene ID: 9208
• mRNA Refseq: NM_001137550
• Protein Refseq: NP_001131022
• MIM: 603256
• UniProt ID: Q32MZ4