Recombinant Human LRRC46 Protein, GST-tagged

• Cat.No.: LRRC46-4661H
• Product Overview: Human LRRC46 full-length ORF ( NP_219481.1, 1 a.a. - 321 a.a.) recombinant protein with GST-tag at N-terminal.

Specification

• Species: Human
• Source: Wheat Germ
• Tag: GST
• Description: LRRC46 (Leucine Rich Repeat Containing 46) is a Protein Coding gene. An important paralog of this gene is LRRC6.
• Molecular Mass: 61.7 kDa
• AA Sequence: MSGGKSAQGPEEGGVCITEALITKRNLTFPEDGELSEKMFHTLDELQTVRLDREGITTIRNLEGLQNLHSLYLQGNKIQQIENLACIPSLRFLSLAGNQIRQVENLLDLPCLQFLDLSENLIETLKLDEFPQSLLILNLSGNSCTNQDGYRELVTEALPLLLDLDGQPVVERWISDEEDEASSDEEFPELSGPFCSERGFLKELEQELSRHREHRQQTALTEHLLRMEMQPTLTDLPLLPGVPMAGDSSPSATPAQGEETVPEAVSSPQASSPTKKPCSLIPRGHQSSFWGRKGARAATAPKASVAEAPSTTKTTAKRSKK
• Applications: Enzyme-linked Immunoabsorbent Assay
  Western Blot (Recombinant protein)
  Antibody Production
  Protein Array
• Notes: Best use within three months from the date of receipt of this protein.
• Storage: Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
• Storage Buffer: 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.

Gene Information

• Gene Name: LRRC46 leucine rich repeat containing 46 [ Homo sapiens ]
• Official Symbol: LRRC46
• Synonyms: LRRC46 leucine rich repeat containing 46 [ Homo sapiens ]
• Gene ID: 90506
• mRNA Refseq: NM_033413
• Protein Refseq: NP_219481
• UniProt ID: Q96FV0