Recombinant Full Length Human LRRC46 Protein, GST-tagged
Cat.No. : | LRRC46-6022HF |
Product Overview : | Human LRRC46 full-length ORF ( NP_219481.1, 1 a.a. - 321 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | In Vitro Cell Free System |
Tag : | GST |
Protein Length : | 321 amino acids |
Description : | LRRC46 (Leucine Rich Repeat Containing 46) is a Protein Coding gene. An important paralog of this gene is LRRC6. |
Molecular Mass : | 61.7 kDa |
AA Sequence : | MSGGKSAQGPEEGGVCITEALITKRNLTFPEDGELSEKMFHTLDELQTVRLDREGITTIRNLEGLQNLHSLYLQGNKIQQIENLACIPSLRFLSLAGNQIRQVENLLDLPCLQFLDLSENLIETLKLDEFPQSLLILNLSGNSCTNQDGYRELVTEALPLLLDLDGQPVVERWISDEEDEASSDEEFPELSGPFCSERGFLKELEQELSRHREHRQQTALTEHLLRMEMQPTLTDLPLLPGVPMAGDSSPSATPAQGEETVPEAVSSPQASSPTKKPCSLIPRGHQSSFWGRKGARAATAPKASVAEAPSTTKTTAKRSKK |
Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
Notes : | Best use within three months from the date of receipt of this protein. |
Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
Storage Buffer : | 50 mM Tris-HCl, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Gene Name | LRRC46 leucine rich repeat containing 46 [ Homo sapiens ] |
Official Symbol | LRRC46 |
Synonyms | LRRC46 leucine rich repeat containing 46 [ Homo sapiens ] |
Gene ID | 90506 |
mRNA Refseq | NM_033413 |
Protein Refseq | NP_219481 |
UniProt ID | Q96FV0 |
◆ Recombinant Proteins | ||
LRRC46-409C | Recombinant Cynomolgus Monkey LRRC46 Protein, His (Fc)-Avi-tagged | +Inquiry |
LRRC46-3468R | Recombinant Rat LRRC46 Protein | +Inquiry |
Lrrc46-3836M | Recombinant Mouse Lrrc46 Protein, Myc/DDK-tagged | +Inquiry |
LRRC46-663C | Recombinant Cynomolgus LRRC46 Protein, His-tagged | +Inquiry |
LRRC46-3124R | Recombinant Rat LRRC46 Protein, His (Fc)-Avi-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
LRRC46-4628HCL | Recombinant Human LRRC46 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All LRRC46 Products
Required fields are marked with *
My Review for All LRRC46 Products
Required fields are marked with *
0
Inquiry Basket