Recombinant Full Length Human LRRC46 Protein, GST-tagged

Cat.No. : LRRC46-6022HF
Product Overview : Human LRRC46 full-length ORF ( NP_219481.1, 1 a.a. - 321 a.a.) recombinant protein with GST-tag at N-terminal.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : In Vitro Cell Free System
Tag : GST
Protein Length : 321 amino acids
Description : LRRC46 (Leucine Rich Repeat Containing 46) is a Protein Coding gene. An important paralog of this gene is LRRC6.
Molecular Mass : 61.7 kDa
AA Sequence : MSGGKSAQGPEEGGVCITEALITKRNLTFPEDGELSEKMFHTLDELQTVRLDREGITTIRNLEGLQNLHSLYLQGNKIQQIENLACIPSLRFLSLAGNQIRQVENLLDLPCLQFLDLSENLIETLKLDEFPQSLLILNLSGNSCTNQDGYRELVTEALPLLLDLDGQPVVERWISDEEDEASSDEEFPELSGPFCSERGFLKELEQELSRHREHRQQTALTEHLLRMEMQPTLTDLPLLPGVPMAGDSSPSATPAQGEETVPEAVSSPQASSPTKKPCSLIPRGHQSSFWGRKGARAATAPKASVAEAPSTTKTTAKRSKK
Applications : Enzyme-linked Immunoabsorbent Assay
Western Blot (Recombinant protein)
Antibody Production
Protein Array
Notes : Best use within three months from the date of receipt of this protein.
Storage : Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
Storage Buffer : 50 mM Tris-HCl, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Gene Name LRRC46 leucine rich repeat containing 46 [ Homo sapiens ]
Official Symbol LRRC46
Synonyms LRRC46 leucine rich repeat containing 46 [ Homo sapiens ]
Gene ID 90506
mRNA Refseq NM_033413
Protein Refseq NP_219481
UniProt ID Q96FV0

Not For Human Consumption!

Inquiry

  • Reviews
  • Q&As

Customer Reviews (0)

Write a review

Q&As (0)

Ask a question

Ask a Question for All LRRC46 Products

Required fields are marked with *

My Review for All LRRC46 Products

Required fields are marked with *

0

Inquiry Basket

cartIcon