Recombinant Human LRRC3 Protein, His tagged

• Cat.No.: LRRC3-001H
• Product Overview: Recombinant Human LRRC3 Protein with His tag was expressed in HEK293.

Specification

• Species: Human
• Source: HEK293
• Tag: His&Non
• Protein Length: 33-204 aa
• Description: Predicted to be located in membrane. Predicted to be active in plasma membrane.
• Molecular Mass: 20 kDa
• Purity: > 90% by SDS-PAGE
• AA Sequence: CPQPCRCPDHAGAVAVFCSLRGLQEVPEDIPANTVLLKLDANKISHLPDGAFQHLHRLRELDLSHNAIEAIGSATFAGLAGGLRLLDLSYNRIQRIPKDALGKLSAKIRLSHNPLHCECALQEALWELKLDPDSVDEIACHTSVQEEFVGKPLVQALDAGASLCSVPHRTTDHHHHHHHH
• Advantages: 1. Sensitive and accurate: The linearity can be kept between 0.5859 μM to 150 μM by using 10 μL sample per test. The "mix-and-read" procedure involves addition of a single working reagent and reading the optical density. Can be readily automated as a high-throughput assay in auto-analyser for thousands of samples per day. 2. Safety: Reagents are non-toxic. 3. Versatility: Assays can be executed in auto-analyser
• Endotoxin: < 1.0 EU/μg by LAL
• Storage: Store it under sterile conditions at -20 to -80 centigrade. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
• Concentration: 1 mg/mL by BCA

Gene Information

• Gene Name: LRRC3 leucine rich repeat containing 3 [ Homo sapiens (human) ]
• Official Symbol: LRRC3
• Synonyms: LRRC3; leucine rich repeat containing 3; leucine-rich repeat-containing protein 3; LRRC3 downstream neighbor (non-protein coding); intronless long ORF, AL117578
• Gene ID: 81543
• mRNA Refseq: NM_030891
• Protein Refseq: NP_112153
• MIM: 617620
• UniProt ID: Q9BY71