Recombinant Human LRP8 Protein, GST-tagged
Cat.No. : | LRP8-4688H |
Product Overview : | Human LRP8 partial ORF ( NP_004622, 83 a.a. - 170 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Wheat Germ |
Tag : | GST |
Description : | This gene encodes an apolipoprotein E receptor, a member of the low density lipoprotein receptor (LDLR) family. Apolipoprotein E is a small lipophilic plasma protein and a component of lipoproteins such as chylomicron remnants, very low density lipoprotein (VLDL), and high density lipoprotein (HDL). The apolipoprotein E receptor is involved in cellular recognition and internalization of these lipoproteins. Alternative splicing generates multiple transcript variants encoding distinct isoforms for this gene. [provided by RefSeq |
Molecular Mass : | 35.42 kDa |
AA Sequence : | KKTCADSDFTCDNGHCIHERWKCDGEEECPDGSDESEATCTKQVCPAEKLSCGPTSHKCVPASWRCDGEKDCEGGADEAGCATLCAPH |
Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
Notes : | Best use within three months from the date of receipt of this protein. |
Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
Storage Buffer : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Gene Name | LRP8 low density lipoprotein receptor-related protein 8, apolipoprotein e receptor [ Homo sapiens ] |
Official Symbol | LRP8 |
Synonyms | LRP8; low density lipoprotein receptor-related protein 8, apolipoprotein e receptor; low-density lipoprotein receptor-related protein 8; APOER2; ApoE receptor 2; MCI1; LRP-8; HSZ75190; |
Gene ID | 7804 |
mRNA Refseq | NM_001018054 |
Protein Refseq | NP_001018064 |
MIM | 602600 |
UniProt ID | Q14114 |
◆ Recombinant Proteins | ||
Lrp8-1339M | Recombinant Mouse Lrp8 Protein, MYC/DDK-tagged | +Inquiry |
LRP8-64H | Active Recombinant Human ApoE R2, CF | +Inquiry |
LRP8-6741C | Recombinant Chicken LRP8 | +Inquiry |
LRP8-022H | Recombinant Human LRP8 Protein, MYC/DDK-tagged, C13 and N15-labeled | +Inquiry |
LRP8-4688H | Recombinant Human LRP8 Protein, GST-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
LRP8-4653HCL | Recombinant Human LRP8 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All LRP8 Products
Required fields are marked with *
My Review for All LRP8 Products
Required fields are marked with *
0
Inquiry Basket