Recombinant Human LRP8 Protein, GST-tagged

• Cat.No.: LRP8-4688H
• Product Overview: Human LRP8 partial ORF ( NP_004622, 83 a.a. - 170 a.a.) recombinant protein with GST-tag at N-terminal.

Specification

• Description: This gene encodes an apolipoprotein E receptor, a member of the low density lipoprotein receptor (LDLR) family. Apolipoprotein E is a small lipophilic plasma protein and a component of lipoproteins such as chylomicron remnants, very low density lipoprotein (VLDL), and high density lipoprotein (HDL). The apolipoprotein E receptor is involved in cellular recognition and internalization of these lipoproteins. Alternative splicing generates multiple transcript variants encoding distinct isoforms for this gene. [provided by RefSeq
• Source: Wheat Germ
• Species: Human
• Tag: GST
• Molecular Mass: 35.42 kDa
• AA Sequence: KKTCADSDFTCDNGHCIHERWKCDGEEECPDGSDESEATCTKQVCPAEKLSCGPTSHKCVPASWRCDGEKDCEGGADEAGCATLCAPH
• Applications: Enzyme-linked Immunoabsorbent Assay
  Western Blot (Recombinant protein)
  Antibody Production
  Protein Array
• Notes: Best use within three months from the date of receipt of this protein.
• Storage: Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
• Storage Buffer: 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.

Gene Information

• Gene Name: LRP8 low density lipoprotein receptor-related protein 8, apolipoprotein e receptor [ Homo sapiens ]
• Official Symbol: LRP8
• Synonyms: LRP8; low density lipoprotein receptor-related protein 8, apolipoprotein e receptor; low-density lipoprotein receptor-related protein 8; APOER2; ApoE receptor 2; MCI1; LRP-8; HSZ75190
• Gene ID: 7804
• mRNA Refseq: NM_001018054
• Protein Refseq: NP_001018064
• MIM: 602600
• UniProt ID: Q14114