Recombinant Human LRP1B Protein, GST-tagged

• Cat.No.: LRP1B-4693H
• Product Overview: Human LRP1B partial ORF ( NP_061027, 111 a.a. - 200 a.a.) recombinant protein with GST-tag at N-terminal.

Specification

• Species: Human
• Source: Wheat Germ
• Tag: GST
• Description: LRP1B belongs to the low density lipoprotein (LDL) receptor gene family. These receptors play a wide variety of roles in normal cell function and development due to their interactions with multiple ligands (Liu et al., 2001 [PubMed 11384978]).[supplied by OMIM
• Molecular Mass: 35.42 kDa
• AA Sequence: VHCQELLSNCQQLNCQYKCTMVRNSTRCYCEDGFEITEDGRSCKDQDECAVYGTCSQTCRNTHGSYTCSCVEGYLMQPDNRSCKAKIEPT
• Applications: Enzyme-linked Immunoabsorbent Assay
  Western Blot (Recombinant protein)
  Antibody Production
  Protein Array
• Notes: Best use within three months from the date of receipt of this protein.
• Storage: Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
• Storage Buffer: 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.

Gene Information

• Gene Name: LRP1B LDL receptor related protein 1B [ Homo sapiens (human) ]
• Official Symbol: LRP1B
• Synonyms: LRP1B; LDL receptor related protein 1B; LRP-1B; LRPDIT; LRP-DIT; low-density lipoprotein receptor-related protein 1B; LRP-deleted in tumors; low density lipoprotein receptor related protein-deleted in tumor; low density lipoprotein receptor-related protein 1B; low density lipoprotein-related protein 1B (deleted in tumors)
• Gene ID: https://www.ncbi.nlm.nih.gov/gene/53353
• mRNA Refseq: NM_018557
• Protein Refseq: NP_061027
• MIM: 608766
• UniProt ID: Q9NZR2