Recombinant Human LRP12 Protein, GST-tagged

• Cat.No.: LRP12-4694H
• Product Overview: Human LRP12 full-length ORF (-, 1 a.a. - 129 a.a.) recombinant protein with GST tag at N-terminal.

Specification

• Species: Human
• Source: Wheat Germ
• Tag: GST
• Description: This gene was identified by its differential expression in cancer cells. The product of this gene is predicted to be a transmembrane protein. The level of this protein was found to be lower in tumor derived cell lines compared to normal cells. This gene was thus proposed to be a candidate tumor suppressor gene. Two transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq
• Molecular Mass: 39.93 kDa
• AA Sequence: MKIFYYALNLELYKTCTKIVQDKFHLVMSFPNTGLRLHWTLGICTKIISRSQMSLVHKHYHFKYYYLLPQQLYISIAFGWGRGTFLLQLEIALLVSYLFVVFKKYIVVRVIFSIYFIPGGDHATLSKEN
• Applications: Enzyme-linked Immunoabsorbent Assay
  Western Blot (Recombinant protein)
  Antibody Production
  Protein Array
• Notes: Best use within three months from the date of receipt of this protein.
• Storage: Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
• Storage Buffer: 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.

Gene Information

• Gene Name: LRP12 low density lipoprotein receptor-related protein 12 [ Homo sapiens ]
• Official Symbol: LRP12
• Synonyms: LRP12; low density lipoprotein receptor-related protein 12; low-density lipoprotein receptor-related protein 12; FLJ12929; ST7; suppressor of tumorigenicity 7 protein; DKFZp781F1053
• Gene ID: 29967
• mRNA Refseq: NM_001135703
• Protein Refseq: NP_001129175
• UniProt ID: Q9Y561