Recombinant Human LRP1 Protein

Cat.No. : LRP1-4698H
Product Overview : Human LRP1 full-length ORF (AAH45107.1) recombinant protein without tag.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : Wheat Germ
Tag : Non
Description : This gene encodes a member of the low-density lipoprotein receptor family of proteins. The encoded preproprotein is proteolytically processed by furin to generate 515 kDa and 85 kDa subunits that form the mature receptor (PMID: 8546712). This receptor is involved in several cellular processes, including intracellular signaling, lipid homeostasis, and clearance of apoptotic cells. In addition, the encoded protein is necessary for the alpha 2-macroglobulin-mediated clearance of secreted amyloid precursor protein and beta-amyloid, the main component of amyloid plaques found in Alzheimer patients. Expression of this gene decreases with age and has been found to be lower than controls in brain tissue from Alzheimer's disease patients. [provided by RefSeq, Oct 2015]
Form : Liquid
Molecular Mass : 31.6 kDa
AA Sequence : MLTPPLLLLLPLLSALVAAAIDAPKTCSPKQFACRDQITCISKGWRCDGERDCPDGSDEAPEICPQSKAQRCQPNEHNCLGTELCVPMSRLCNGVQDCMDGSDEGPHCRELQGNCSRLGCQHHCVPTLDGPTCYCNSSFQLQADGKTCKDFDECSVYGTCSQLCTNTDGSFICGCVEGYLLQPDNRSCKAKNEPVDRPPVLLIANSQNILATYLSGAQVSTITPTSTRQTTAMDFSYANETVCWVHVGDSAAQTQLKCARMPGLKGFVDEHTINISLSLHLCVFSKSQQEMG
Applications : Antibody Production
Functional Study
Compound Screening
Usage : Heating may cause protein aggregation. Please do not heat this product before electrophoresis.
Notes : Best use within three months from the date of receipt of this protein.
Storage : Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
Storage Buffer : 25 mM Tris-HCl of pH8.0 containing 2% glycerol.
Gene Name LRP1 low density lipoprotein receptor-related protein 1 [ Homo sapiens ]
Official Symbol LRP1
Synonyms LRP1; low density lipoprotein receptor-related protein 1; A2MR, alpha 2 macroglobulin receptor , APR; prolow-density lipoprotein receptor-related protein 1; CD91; LRP; LRP-1; type V tgf-beta receptor; apolipoprotein E receptor; alpha-2-macroglobulin receptor; TbetaR-V/LRP-1/IGFBP-3 receptor; APR; A2MR; APOER; TGFBR5; IGFBP3R; FLJ16451; MGC88725;
Gene ID 4035
mRNA Refseq NM_002332
Protein Refseq NP_002323
MIM 107770
UniProt ID Q07954

Not For Human Consumption!

Inquiry

  • Reviews
  • Q&As

Customer Reviews (0)

Write a review

Q&As (0)

Ask a question

Ask a Question for All LRP1 Products

Required fields are marked with *

My Review for All LRP1 Products

Required fields are marked with *

0

Inquiry Basket

cartIcon