Recombinant Human LRIG3 Protein, GST-tagged

• Cat.No.: LRIG3-4702H
• Product Overview: Human LRIG3 partial ORF ( NP_700356, 1020 a.a. - 1119 a.a.) recombinant protein with GST-tag at N-terminal.

Specification

• Species: Human
• Source: Wheat Germ
• Tag: GST
• Description: LRIG3 (Leucine Rich Repeats And Immunoglobulin Like Domains 3) is a Protein Coding gene. An important paralog of this gene is LRIG2.
• Molecular Mass: 36.74 kDa
• AA Sequence: LDFSANPEPASVASSNSFMGTFGKALRRPHLDAYSSFGQPSDCQPRAFYLKAHSSPDLDSGSEEDGKERTDFQEENHICTFKQTLENYRTPNFQSYDLDT
• Applications: Enzyme-linked Immunoabsorbent Assay
  Western Blot (Recombinant protein)
  Antibody Production
  Protein Array
• Notes: Best use within three months from the date of receipt of this protein.
• Storage: Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
• Storage Buffer: 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.

Gene Information

• Gene Name: LRIG3 leucine-rich repeats and immunoglobulin-like domains 3 [ Homo sapiens ]
• Official Symbol: LRIG3
• Synonyms: LRIG3; leucine-rich repeats and immunoglobulin-like domains 3; leucine-rich repeats and immunoglobulin-like domains protein 3; FLJ90440; KIAA3016; LIG-3; LIG3; FLJ26573
• Gene ID: 121227
• mRNA Refseq: NM_001136051
• Protein Refseq: NP_001129523
• MIM: 608870
• UniProt ID: Q6UXM1