Recombinant Human LRGUK Protein, GST-tagged

• Cat.No.: LRGUK-4308H
• Product Overview: Human FLJ32786 partial ORF ( NP_653249, 721 a.a. - 825 a.a.) recombinant protein with GST-tag at N-terminal.

Specification

• Species: Human
• Source: Wheat Germ
• Tag: GST
• Description: LRGUK (Leucine Rich Repeats And Guanylate Kinase Domain Containing) is a Protein Coding gene. GO annotations related to this gene include kinase activity. An important paralog of this gene is LRRC23.
• Molecular Mass: 37.29 kDa
• AA Sequence: YFKPPFGPYPEKSGKDSLVSMKCSLFRFCPWSKELPFQPPEGSISSHLGSGASDSETEETRKALPIQSFSHEKESHQHRQHSVPVISRPGSNVKPTLPPIPQGRR
• Applications: Enzyme-linked Immunoabsorbent Assay
  Western Blot (Recombinant protein)
  Antibody Production
  Protein Array
• Notes: Best use within three months from the date of receipt of this protein.
• Storage: Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
• Storage Buffer: 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.

Gene Information

• Gene Name: LRGUK leucine-rich repeats and guanylate kinase domain containing [ Homo sapiens ]
• Official Symbol: LRGUK
• Synonyms: LRGUK; leucine-rich repeats and guanylate kinase domain containing; leucine-rich repeat and guanylate kinase domain-containing protein; FLJ32786
• Gene ID: 136332
• mRNA Refseq: NM_144648
• Protein Refseq: NP_653249
• MIM: 616478
• UniProt ID: Q96M69