Recombinant Human LPPR4 protein, GST-tagged

• Cat.No.: LPPR4-039H
• Product Overview: Recombinant Human LPPR4 protein(NP_001159724)(594-763 aa), fused to GST tag, was expressed in E. coli.

Specification

• Species: Human
• Source: E.coli
• Tag: GST
• ProteinLength: 594-763 aa
• Form: The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH8.). 5 % trehalose and 5 % mannitol are added as protectants before lyophilization.
• AA Sequence: SCTGSIRYKTLTDHEPSGIVRVEAHTENNRPIIQIPSTEGEGSGSWKWKAPEKGSLRQTYELNDLNRDSESCESLKDSFGSGDRKRSNIDSNEHHHHGITTIRVTPVEGSEIGSETLSISSSRDSTLRRKGNIILIPERSNSPENTRNIFYKGTSPTRAYKD
• Purity: 95%, by SDS-PAGE with Coomassie Brilliant Blue staining.
• Storage: Short-term storage: Store at 2-8°C for (1-2 weeks).
  Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, buffer containing 50% glycerol is recommended for reconstitution. Avoid repeat freeze-thaw cycles.
• Reconstitution: Reconstitute at 0.25 µg/μl in 200 μl sterile water for short-term storage.
  Reconstitution with 200 μl 50% glycerol solution is recommended for longer term storage (see Stability and Storage for more details).
  If a different concentration is needed for your purposes please adjust the reconstitution volume as required (please note: the ion concentration of the final solution will vary according to the volume used).
  Note: Centrifuge vial before opening. When reconstituting, gently pipet and wash down the sides of the vial to ensure full recovery of the protein into solution.

Gene Information

• Gene Name: LPPR4 lipid phosphate phosphatase-related protein type 4 [ Homo sapiens ]
• Official Symbol: LPPR4
• Synonyms: LPPR4; lipid phosphate phosphatase-related protein type 4; plasticity related gene 1; plasticity-related gene 1 protein; brain-specific phosphatidic acid phosphatase-like protein 1; LPR4; PHP1; PRG1; PRG-1; RP4-788L13.1; KIAA0455
• Gene ID: 9890
• mRNA Refseq: NM_001166252
• Protein Refseq: NP_001159724