Recombinant Human LPO Protein, GST-tagged

• Cat.No.: LPO-4714H
• Product Overview: Human LPO full-length ORF (1 a.a. - 177 a.a.) recombinant protein with GST-tag at N-terminal.

Specification

• Description: This gene encodes an oxidoreductase secreted from salivary, mammary, and other mucosal glands that functions as a natural antibacterial agent. Multiple transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq
• Source: Wheat Germ
• Species: Human
• Tag: GST
• Molecular Mass: 45.6 kDa
• AA Sequence: MSSETPTSRQLSEYLKHAKGRTRTAIRNGQVWEESLKRLRQKASLTNVTDPSLDLTSLSLEVGCGAPAPVVRCDPCSPYRTITGDCNNRWRGLGCGGRPFQPLRPALPRPLSLGHSRQICHCLAHLGWRSHLPHLLKIARLQPSPSSPLCVSGSGTFPRGGGAPRLQGVGAVQRPQI
• Applications: Enzyme-linked Immunoabsorbent Assay
  Western Blot (Recombinant protein)
  Antibody Production
  Protein Array
• Notes: Best use within three months from the date of receipt of this protein.
• Storage: Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
• Storage Buffer: 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.

Gene Information

• Gene Name: LPO lactoperoxidase [ Homo sapiens ]
• Official Symbol: LPO
• Synonyms: LPO; lactoperoxidase; SPO; salivary peroxidase; MGC129990; MGC129991
• Gene ID: 4025
• mRNA Refseq: NM_001160102
• Protein Refseq: NP_001153574
• MIM: 150205
• UniProt ID: P22079