Recombinant Human LPO Protein, GST-tagged
Cat.No. : | LPO-4714H |
Product Overview : | Human LPO full-length ORF (1 a.a. - 177 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
Description : | This gene encodes an oxidoreductase secreted from salivary, mammary, and other mucosal glands that functions as a natural antibacterial agent. Multiple transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq |
Source : | Wheat Germ |
Species : | Human |
Tag : | GST |
Molecular Mass : | 45.6 kDa |
AA Sequence : | MSSETPTSRQLSEYLKHAKGRTRTAIRNGQVWEESLKRLRQKASLTNVTDPSLDLTSLSLEVGCGAPAPVVRCDPCSPYRTITGDCNNRWRGLGCGGRPFQPLRPALPRPLSLGHSRQICHCLAHLGWRSHLPHLLKIARLQPSPSSPLCVSGSGTFPRGGGAPRLQGVGAVQRPQI |
Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
Notes : | Best use within three months from the date of receipt of this protein. |
Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
Storage Buffer : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Gene Name | LPO lactoperoxidase [ Homo sapiens ] |
Official Symbol | LPO |
Synonyms | LPO; lactoperoxidase; SPO; salivary peroxidase; MGC129990; MGC129991; |
Gene ID | 4025 |
mRNA Refseq | NM_001160102 |
Protein Refseq | NP_001153574 |
MIM | 150205 |
UniProt ID | P22079 |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Q&As (0)
Ask a questionAsk a Question for All LPO Products
Required fields are marked with *
My Review for All LPO Products
Required fields are marked with *
0
Inquiry Basket