Recombinant Human LOX protein, T7/His-tagged
Cat.No. : | LOX-157H |
Product Overview : | Recombinant human LOX cDNA (169 - 417aa, Isoform-1, which derived from BC074872) fused with T7-His-TEV cleavage site Tag at N-terminal was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His&T7 |
ProteinLength : | 169-417 a.a. |
Form : | 0.5 mg/ml, sterile-filtered, in 20 mM pH 8.0 Tris-HCl Buffer, with proprietary formulation of NaCl, KCl, EDTA, Sucrose and DTT. |
AA Sequence : | MASMTGGQQMGRGHHHHHHGNLYFQGGEFDDPYNPYKYSDDNPYYNYYDTYERPRPGGRYRPGYGTGYFQYGLPD LVADPYYIQASTYVQKMSMYNLRCAAEENCLASTAYRADVRDYDHRVLLRFPQRVKNQGTSDFLPSRPRYSWEWH SCHQHYHSMDEFSHYDLLDANTQRRVAEGHKASFCLEDTSCDYGYHRRFACTAHTQGLSPGCYDTYGADIDCQWI DITDVKPGNYILKVSVNPSYLVPESDYTNNVVRCDIRYTGHHAYASGCTISPY |
Purity : | >90% by SDS-PAGE |
Storage : | Keep at -80 centigrade for long term storage. Product is stable at 4 centigrade for at least 7 days. |
Gene Name | LOX lysyl oxidase [ Homo sapiens ] |
Official Symbol | LOX |
Synonyms | LOX; lysyl oxidase; protein-lysine 6-oxidase; MGC105112; |
Gene ID | 4015 |
mRNA Refseq | NM_001178102 |
Protein Refseq | NP_001171573 |
MIM | 153455 |
UniProt ID | P28300 |
Chromosome Location | 5q23.3-q31.2 |
Function | copper ion binding; metal ion binding; oxidoreductase activity; protein-lysine 6-oxidase activity; |
◆ Recombinant Proteins | ||
Slc3a2-1196M | Recombinant Mouse Slc3a2 protein, His & GST-tagged | +Inquiry |
PROX1-01H | Recombinant Human PROX1 Protein, His-tagged | +Inquiry |
Apoa2-18M | Recombinant Mouse Apoa2, GST-tagged | +Inquiry |
YWHAG-6934H | Recombinant Human Tyrosine 3-Monooxygenase/Tryptophan 5-Monooxygenase Activation Protein, Gamma Polypeptide | +Inquiry |
PDGFC-208H | Active Recombinant Human PDGFC, His-tagged | +Inquiry |
◆ Native Proteins | ||
FGG -60R | Native Rabbit Fibrinogen | +Inquiry |
HB-44R | Native Rabbit Hemoglobin (HB) Protein | +Inquiry |
Laminin-01H | Native Human Laminin Protein | +Inquiry |
SAP-96H | Native Human Serum amyloid P | +Inquiry |
Ferrous Hemoglobin-032B | Native Bovine Ferrous Hemoglobin Protein | +Inquiry |
◆ Cell & Tissue Lysates | ||
SUGP2-1589HCL | Recombinant Human SUGP2 cell lysate | +Inquiry |
ATP5S-8594HCL | Recombinant Human ATP5S 293 Cell Lysate | +Inquiry |
HA-2339HCL | Recombinant H1N1 HA cell lysate | +Inquiry |
STMN4-1394HCL | Recombinant Human STMN4 293 Cell Lysate | +Inquiry |
RBM22-2478HCL | Recombinant Human RBM22 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All LOX Products
Required fields are marked with *
My Review for All LOX Products
Required fields are marked with *
0
Inquiry Basket