Recombinant Human LMO2 Protein, Myc/DDK-tagged, C13 and N15-labeled

• Cat.No.: LMO2-2611H
• Product Overview: LMO2 MS Standard C13 and N15-labeled recombinant protein (NP_001135787) with a C-terminal MYC/DDK tag, was expressed in HEK293 cells.

Specification

• Species: Human
• Source: HEK293
• Tag: Myc&DDK
• Description: LMO2 encodes a cysteine-rich, two LIM-domain protein that is required for yolk sac erythropoiesis. The LMO2 protein has a central and crucial role in hematopoietic development and is highly conserved. The LMO2 transcription start site is located approximately 25 kb downstream from the 11p13 T-cell translocation cluster (11p13 ttc), where a number T-cell acute lymphoblastic leukemia-specific translocations occur. Alternative splicing results in multiple transcript variants encoding different isoforms.
• Molecular Mass: 18.2 kDa
• AA Sequence: MSSAIERKSLDPSEEPVDEVLQIPPSLLTCGGCQQNIGDRYFLKAIDQYWHEDCLSCDLCGCRLGEVGRRLYYKLGRKLCRRDYLRLFGQDGLCASCDKRIRAYEMTMRVKDKVYHLECFKCAACQKHFCVGDRYLLINSDIVCEQDIYEWTKINGMITRTRPLEQKLISEEDLAANDILDYKDDDDKV
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Stability: Stable for 3 months from receipt of products under proper storage and handling conditions.
• Storage: Store at -80 centigrade. Avoid repeated freeze-thaw cycles.
• Concentration: 50 μg/mL as determined by BCA
• Storage Buffer: 100 mM glycine, 25 mM Tris-HCl, pH 7.3.

Gene Information

• Gene Name: LMO2 LIM domain only 2 [ Homo sapiens (human) ]
• Official Symbol: LMO2
• Synonyms: LMO2; LIM domain only 2 (rhombotin-like 1); RBTNL1; rhombotin-2; RBTN2; RHOM2; rhombotin like 1; T cell translocation gene 2; TTG2; LMO-2; rhombotin 2; rhombotin-like 1; LIM domain only protein 2; T-cell translocation gene 2; cysteine-rich protein TTG-2; T-cell translocation protein 2
• Gene ID: 4005
• mRNA Refseq: NM_001142315
• Protein Refseq: NP_001135787
• MIM: 180385
• UniProt ID: P25791