Recombinant Human LLGL2

• Cat.No.: LLGL2-29145TH
• Product Overview: Recombinant fragment of Human LLGL2 with N terminal proprietary tag, 36.52 kDa.

Specification

• Species: Human
• Source: Wheat Germ
• Tag: Non
• Protein Length: 99 amino acids
• Description: The lethal (2) giant larvae protein of Drosophila plays a role in asymmetric cell division, epithelial cell polarity, and cell migration. This human gene encodes a protein similar to lethal (2) giant larvae of Drosophila. In fly, the proteins ability to localize cell fate determinants is regulated by the atypical protein kinase C (aPKC). In human, this protein interacts with aPKC-containing complexes and is cortically localized in mitotic cells. Alternative splicing results in multiple transcript variants encoding different isoforms.
• Molecular Weight: 36.520kDa inclusive of tags
• Form: Liquid
• Purity: Proprietary Purification
• Storage buffer: pH: 8.00Constituents:0.3% Glutathione, 0.79% Tris HCl
• Storage: Shipped on dry ice. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles.
• Sequences of amino acids: SLKVKGGASELQEDESFTLRGPPGAAPSATQITVVLPHSSCELLYLGTESGNVFVVQLPAFRALEDRTISSDAVLQRLPEEARHRRVFEMVEALQEHPR
• Sequence Similarities: Belongs to the WD repeat L(2)GL family.Contains 14 WD repeats.

Gene Information

• Gene Name: LLGL2 lethal giant larvae homolog 2 (Drosophila) [ Homo sapiens ]
• Official Symbol: LLGL2
• Synonyms: LLGL2; lethal giant larvae homolog 2 (Drosophila); lethal giant larvae (Drosophila) homolog 2; lethal(2) giant larvae protein homolog 2; HGL
• Gene ID: 3993
• mRNA Refseq: NM_001015002
• Protein Refseq: NP_001015002
• Uniprot ID: Q6P1M3
• Chromosome Location: 17q25.1
• Pathway: Tight junction, organism-specific biosystem; Tight junction, conserved biosystem
• Function: PDZ domain binding; protein binding