Recombinant Human LITAF Protein, Myc/DDK-tagged, C13 and N15-labeled

• Cat.No.: LITAF-5641H
• Product Overview: LITAF MS Standard C13 and N15-labeled recombinant protein (NP_004853) with a C-terminal MYC/DDK tag, was expressed in HEK293 cells.

Specification

• Species: Human
• Source: HEK293
• Tag: DDK&Myc
• Description: Lipopolysaccharide is a potent stimulator of monocytes and macrophages, causing secretion of tumor necrosis factor-alpha (TNF-alpha) and other inflammatory mediators. This gene encodes lipopolysaccharide-induced TNF-alpha factor, which is a DNA-binding protein and can mediate the TNF-alpha expression by direct binding to the promoter region of the TNF-alpha gene. The transcription of this gene is induced by tumor suppressor p53 and has been implicated in the p53-induced apoptotic pathway. Mutations in this gene cause Charcot-Marie-Tooth disease type 1C (CMT1C) and may be involved in the carcinogenesis of extramammary Paget's disease (EMPD). Multiple alternatively spliced transcript variants have been found for this gene.
• Molecular Mass: 17.1 kDa
• AA Sequence: MSVPGPYQAATGPSSAPSAPPSYEETVAVNSYYPTPPAPMPGPTTGLVTGPDGKGMNPPSYYTQPAPIPNNNPITVQTVYVQHPITFLDRPIQMCCPSCNKMIVSQLSYNAGALTWLSCGSLCLLGCIAGCCFIPFCVDALQDVDHYCPNCRALLGTYKRLTRTRPLEQKLISEEDLAANDILDYKDDDDKV
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Stability: Stable for 3 months from receipt of products under proper storage and handling conditions.
• Storage: Store at -80 centigrade. Avoid repeated freeze-thaw cycles.
• Concentration: 50 μg/mL as determined by BCA
• Storage Buffer: 100 mM glycine, 25 mM Tris-HCl, pH 7.3.

Gene Information

• Gene Name: LITAF lipopolysaccharide-induced TNF factor [ Homo sapiens (human) ]
• Official Symbol: LITAF
• Synonyms: LITAF; lipopolysaccharide-induced TNF factor; lipopolysaccharide-induced tumor necrosis factor-alpha factor; FLJ38636; PIG7; SIMPLE; TP53I7; p53-induced gene 7 protein; LPS-induced TNF-alpha factor; tumor protein p53 inducible protein 7; lipopolysaccharide-induced TNF-alpha factor; small integral membrane protein of lysosome/late endosome; MGC116698; MGC116700; MGC116701; MGC125274; MGC125275; MGC125276
• Gene ID: 9516
• mRNA Refseq: NM_004862
• Protein Refseq: NP_004853
• MIM: 603795
• UniProt ID: Q99732